Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Platelet-Type Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


h-p12-lox       GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLLQ 60
bt-p12-lox      ------------------------------------------------------------
m-p12-lox       GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPARGKEEEFDFDVPEDLGPLQ 60
                                                                            

hp-12-lox       FVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNAL 120
bt-p-12-lox     -----------------------------------------DGVLCLPERTARLAGNNAL 19
mp-12-lox       FVKLHKQHTVVDDAWFCNLITVQGPGTSAEAVFPCYRWVQGEGILSLPEGQARLAGDNAL 120
                                                         :.:*.***  ***.*:***

hp-12-lox       DMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAG 180
bt-p-12-lox     DVFQRHREKELKERHKIYRWATWKEGLPLTIAAGSEDDLPANMRFHEEKRLDFEWTLKAG 79
mp-12-lox       DVFQKYREKELKERQQTYCWATWKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKAG 180
                *:**::******:*:: * ********* ****. :****.*******************

hp-12-lox       ALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLL 240
bt-p-12-lox     TLEMVLKRVYTLLSSWTSLEDFDLIFWGQKSPLAEKVHQCWRDDELFGYQFLNGANPMLL 139
mp-12-lox       VLEMGLKRVYTLLRSWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLL 240
                .*** ******** **. ***** *******.*****:***::****.************

hp-12-lox       RRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLV 300
bt-p-12-lox     RRCTSLPTRLVLPSGMEELRAQLERELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLV 199
mp-12-lox       RRSTSLPSRLVLPSGMEELQAQLEKELKNGSLFEADFILLDGIPANVIRGEPQYLAAPLV 300
                **.****:***********:****:**:*********************** ********

hp-12-lox       MLKMEPNGKLQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHL 360
bt-p-12-lox     MLKMDPSGKLLPMVIQIQPPSPISPTPPLFLPSDPPLAWLLAKTWVRNSDFQLHQLQYHL 259
mp-12-lox       MLRMDPGGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHL 360
                **:*:*.*** **.******.* **:*.*************** *********:::*:**

hp-12-lox       LNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTG 420
bt-p-12-lox     LNTHLLAEVIAVATMRCLPGLHPVFKLLMPHIRYTMEINTRARTQLISDGGIFDKAVSTG 319
mp-12-lox       LNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTG 420
                *****:*****************:**:*:************:************:.****

hp-12-lox       GGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHL 480
bt-p-12-lox     GGGHVHLLRRALAQLTYRSLCPLDDLADRRLLGTPGALYACDALRLWEITARYVEGIVHL 379
mp-12-lox       GGGHVQLLTRAVAQLTYHSLCPPDDLANRGLLRIPSALYARDALQLWEVTARYVKGMVHL 480
                *****:** ** ***** **** ****:* **  *.**** ***:***: ****:*:***

hp-12-lox       FYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHA 540
bt-p-12-lox     FYHGDDVVKGDPELQAWCREITEVGLPQAQERGFPVSFQSQNQLCHFLTMCVFTCTAQHG 439
mp-12-lox       FYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHA 540
                **: **:*:***************** :**:*********: *****************.

hp-12-lox       AINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQ 600
bt-p-12-lox     AINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAITWHLGRRQ 499
mp-12-lox       AINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQ 600
                **********.***************:*:**** *********::*****:*:***.* *

hp-12-lox       PDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSV 660
bt-p-12-lox     PDMVPLGHHKEKYFSDPKAKSVLNQFQTDLENLEREITARNEQLDLPYEYLKPSHI---- 555
mp-12-lox       PDMVPLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSI 660
                *********.*****.*:.*:**.**::**::**:********** ******** *

hp-12-lox       TI 662
bt-p-12-lox     --
mp-12-lox       TI 662