Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Platelet-Type Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

h-p12-lox   GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLLQ   60
bt-p12-lox  ------------------------------------------------------------    0
m-p12-lox   GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPARGKEEEFDFDVPEDLGPLQ   60
                                                                     

h-p12-lox   FVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNAL  120
bt-p12-lox  -----------------------------------------DGVLCLPERTARLAGNNAL   19
m-p12-lox   FVKLHKQHTVVDDAWFCNLITVQGPGTSAEAVFPCYRWVQGEGILSLPEGQARLAGDNAL  120
                                                     * ***  *** * ***

h-p12-lox   DMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAG  180
bt-p12-lox  DVFQRHREKELKERHKIYRWATWKEGLPLTIAAGSEDDLPANMRFHEEKRLDFEWTLKAG   79
m-p12-lox   DVFQKYREKELKERQQTYCWATWKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKAG  180
            * **  ****** *   * ********* ****   **** *******************

h-p12-lox   ALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLL  240
bt-p12-lox  TLEMVLKRVYTLLSSWTSLEDFDLIFWGQKSPLAEKVHQCWRDDELFGYQFLNGANPMLL  139
m-p12-lox   VLEMGLKRVYTLLRSWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLL  240
             *** ******** **  ***** ******* ***** ***  **** ************

h-p12-lox   RRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLV  300
bt-p12-lox  RRCTSLPTRLVLPSGMEELRAQLERELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLV  199
m-p12-lox   RRSTSLPSRLVLPSGMEELQAQLEKELKNGSLFEADFILLDGIPANVIRGEPQYLAAPLV  300
            ** **** *********** **** ** *********************** ********

h-p12-lox   MLKMEPNGKLQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHL  360
bt-p12-lox  MLKMDPSGKLLPMVIQIQPPSPISPTPPLFLPSDPPLAWLLAKTWVRNSDFQLHQLQYHL  259
m-p12-lox   MLRMDPGGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHL  360
            ** * * *** ** ****** * ** * *************** *********   * **

h-p12-lox   LNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTG  420
bt-p12-lox  LNTHLLAEVIAVATMRCLPGLHPVFKLLMPHIRYTMEINTRARTQLISDGGIFDKAVSTG  319
m-p12-lox   LNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTG  420
            ***** ***************** ** * ************ ************  ****

h-p12-lox   GGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHL  480
bt-p12-lox  GGGHVHLLRRALAQLTYRSLCPLDDLADRRLLGTPGALYACDALRLWEITARYVEGIVHL  379
m-p12-lox   GGGHVQLLTRAVAQLTYHSLCPPDDLANRGLLRIPSALYARDALQLWEVTARYVKGMVHL  480
            ***** ** ** ***** **** **** * **  * **** *** ***  **** * ***

h-p12-lox   FYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHA  540
bt-p12-lox  FYHGDDVVKGDPELQAWCREITEVGLPQAQERGFPVSFQSQNQLCHFLTMCVFTCTAQHG  439
m-p12-lox   FYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHA  540
            **  ** * *****************  ** *********  *****************

h-p12-lox   AINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQ  600
bt-p12-lox  AINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAITWHLGRRQ  499
m-p12-lox   AINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQ  600
            ********** *************** * **** *********  ***** * *** * *

h-p12-lox   PDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSV  660
bt-p12-lox  PDMVPLGHHKEKYFSDPKAKSVLNQFQTDLENLEREITARNEQLDLPYEYLKPSHI----  555
m-p12-lox   PDMVPLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSI  660
            ********* ***** *  * ** **  **  ** ********** ******** *

h-p12-lox   TI  662
bt-p12-lox  --  555
m-p12-lox   TI  662
                

Conserved Residues: 447 (min. 67.5%, max. 80.5%)