Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Plant 9-Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


st-9-13-lox       -----------------MIGQITSG--LFGGHDDSKKVKGTVVMMNKNVLDFTDLAGSLT 41
st-9-lox          ----------------MNIGQIMGGRELFGGHDDSKKVKGTVVMMKKNALDFTDLAGSLT 44
pd-9-lox          --------------MLHNLFDKITGQEQNGKN--GRKIKGTVVLMKKNVLDFNDFNASVL 44
hv-lox-a          ----------------MLLGGLIDT---LTGANKSARLKGTVVLMRKNVLDLNDFGATII 41
                                                      :::****:*.* .**:.*. .::

st-9-13-lox       GKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFD 101
st-9-lox          DIAFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFD 104
pd-9-lox          DRVHELLGQGVSLQLISADHGDSENGFKGKLGEPAYLEDWITTITPLTVG-DSAYNVTFD 103
hv-lox-a          DGIGEFLGKGVTCQLISSTAVDQDNGGRGKVGAEAELEQWVTSLPSLTTG-ESKFGLTFD 100
                  .   :.:*: *: ****:      .*  *  .  * **: : :: .  .. :    : *:

st-9-13-lox       WN-EEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH-GKVHFVCNSWVYPSLNYKSDRIFF 159
st-9-lox          WN-EEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH-GKVHFDCNSWVYPSFRYKSDRIFF 162
pd-9-lox          WE-EEIGVPGAILIKNNHHSEFFLKTVTLEDVPRE-GRVHFVCNSWVYPAEKYTKDRVFF 161
hv-lox-a          WEVEKLGVPGAIVVNNYHSSEFLLKTITLHDVPGRSGNLTFVANSWIYPAANYRYSRVFF 160
                  *: *.:*****: :.* * .:* **::**.***   * : * .***:**: .*  .*:**

st-9-13-lox       ANQPYLPSETPELLRKYRENELLTLRGDGT-GKREAWDRIYDYDIYNDLGNPDQGKENVR 218
st-9-lox          ANQPYLPSKTPELLRKYRENELLTLRGDGT-GKREAWDRIYDYDIYNDLGNPDQGKENVR 221
pd-9-lox          VNKTFLPSETPLPLRKYREEELVHLRGDGK-GELQEWDRVYDYAYYNDLGNPDKGSKYAR 220
hv-lox-a          ANDTYLPSQMPAALKPYRDDELRNLRGDDQQGPYQEHDRIYRYDVYNDLGEG-------R 213
                   *..:***: *  *: **::**  ****.  *  :  **:* *  *****         *

st-9-13-lox       TTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILSLDIYVPRDERFGHLKMSDFLTYA 278
st-9-lox          TTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLLLSLDIYVPRDERFGHLKMSDFLTYA 281
pd-9-lox          PTLGGSSGYPYPPRGRTGRPATKTDPNSESRIPLIMSLNVYVPRDERFGHLKLSDFLAYA 280
hv-lox-a          PILGGNSDHPYPRRGRTERKPNASDPSLESRLS--LLEQIYVPRDEKFGHLKTSDFLGYS 271
                  . ***.  .*** **** * .  :**. * *:.  :  ::******:* :** **** *:

st-9-13-lox       LKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIREL 338
st-9-lox          LKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIKEL 341
pd-9-lox          LKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPLPEG-LLKDIGDNIPAEMLKEI 339
hv-lox-a          IKAITQGILPAVRTYVDTTPGEFDSFQDIINLYEGGIKLPKVAALEELRKQFPLQLIKDL 331
                  :*::.* : * :.:  * * .***.*:*:: ** **: **    :  :   .* ::::::

st-9-13-lox       LRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAY 398
st-9-lox          LRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAY 401
pd-9-lox          FRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNISLLQEFPPASKLNPKVY 399
hv-lox-a          LPVGGDSLLKLPVPHIIQENKQAWRTDEEFAREVLAGVNPVMITRLTEFPPKSSLDPSKF 391
                  :  .*  :*::* * :*::.* ********.**:******: *  * **** *.*:*. :

st-9-13-lox       GNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPYLRRIN-TTITKTYASRTL 457
st-9-lox          GNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDLLIPYLRRIN-TTITKSYASRTL 460
pd-9-lox          GDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDALMPYLRRIN-STSNKIYASRTV 458
hv-lox-a          GDHTSTITAEHIEKNLEGLTVQQALESNRLYILDHHDRFMPFLIDVNNLPGNFIYATRTL 451
                  *.:.* ** :.* .:*:***:.:*:: *:*:**:*** ::*::  :*  . .  **:**:

st-9-13-lox       LFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTPSDQG-VESSIWQLAKAYVAVNDTGV 516
st-9-lox          LFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTPSDQG-VESSIWQLAKAYVAVNDAGV 519
pd-9-lox          LFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG-VEGSIWQLAKAYVAVNDSGY 517
hv-lox-a          FFLRGDGRLTPLAIELSEPIIQGGLTTAKSKVYTPVPSGSVEGWVWELAKAYVAVNDSGW 511
                  ::*:.:* *.**.**** *  :*      ***:**   * **. :*:**********:*

st-9-13-lox       HQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFRDTMNINASARQILVNAGGVL 576
st-9-lox          HQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFRDTMNINASARQILINAGGVL 579
pd-9-lox          HQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFRDTMNINAFARQIVINAGGIL 577
hv-lox-a          HQLVSHWLNTHAVMEPFVISTNRHLSVTHPVHKLLSPHYRDTMTINALARQTLINAGGIF 571
                  ***:********* **.:*.***:*** **::*** **:****.*** *** ::****::

st-9-13-lox       ESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVD 636
st-9-lox          ESTVFQSKFALEMSAVVYKDWVFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVD 639
pd-9-lox          ETTVFPSRYAMELSSVVYKDWVFTEQALPADLIKRGVAVKDANSPHGLRLLIEDYPYAVD 637
hv-lox-a          EMTVFPGKFALGMSAVVYKDWKFTEQGLPDDLIKRGMAVEDPSSPYKVRLLVSDYPYAAD 631
                  * *** .::*: :*:*:**:* *.:*. * **:***:*: *..**: ::**:.*****.*

st-9-13-lox       GLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQ 696
st-9-lox          GLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQ 699
pd-9-lox          GIEIWFAIKTWVEDYCSFYYKTDDIIQEDTELQSWWKELVEEGHGDKKDEPWWPKMQTRE 697
hv-lox-a          GLAIWHAIEQYVSEYLAIYYPNDGVLQGDTEVQAWWKETREVGHGDLKDAPWWPKMQSVP 691
                  *: ** **: :* :*  :** .*  :  *.*:*:**.*    **** *: ****:*::

st-9-13-lox       ELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKA 756
st-9-lox          ELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKA 759
pd-9-lox          DLVETCTIIIWTASALHAAVNFGQFPYAGYLPNRPTLSRKFMPEKGTPEYKELESSPDTV 757
hv-lox-a          ELAKACTTIIWIGSALHAAVNFGQYPYAGFLPNRPTVSRRRMPEPGTEEYAELERDPERA 751
                  :* .:** *** .***********:****:******:**: *** ** :: **: .*: .

st-9-13-lox       FLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIE 816
st-9-lox          FLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIE 819
pd-9-lox          FLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAKIE 817
hv-lox-a          FIHTITSQIQTIIGVSLLEVLSKHSSDELYLGQRDTPEWTSDPKALEVFKRFSDRLVEIE 811
                  :::***:*:**::*::*:* **:*: **:*****::**** * :.* .*.:*. :* .**

st-9-13-lox       KQIIQRNGDNILTNRSGPVNAPYTLLFPTS------EGGLTGKGIPNSVSI 861
st-9-lox          KQIIQRNGDNILTNRSGPVNAPYTLLFPTS------EGGLTGKGIPNSVSI 864
pd-9-lox          DRITSMNNDEKLKNRVGPVKMPYTLLFPTS------GGGLTGRGIPNSVSI 862
hv-lox-a          SKVVGMNHDPELKNRNGPAKFPYMLLYPNTSDHKGAAAGLTAKGIPNSISI 862
                  .::   * :    ** **.: ** :*:*.:        **..:*****:**