Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Plant 9-Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon


st-9-13-lox ---MIGQITSG--LFGGHDDSKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQ   55
st-9-lox    --MNIGQIMGGRELFGGHDDSKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQ   58
pd-9-lox    MLHNLFDKITGQEQNGKN--GRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ   58
hv-lox-a    --MLLGGLIDT---LTGANKSARLKGTVVLMRKNVLDLNDFGATIIDGIGEFLGKGVTCQ   55
                                    ***** * ** **  *            **  *  *

st-9-13-lox LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWN-EEFGVPGAFII  114
st-9-lox    LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWN-EEFGVPGAFII  117
pd-9-lox    LISADHGDSENGFKGKLGEPAYLEDWITTITPLTVG-DSAYNVTFDWE-EEIGVPGAILI  116
hv-lox-a    LISSTAVDQDNGGRGKVGAEAELEQWVTSLPSLTTG-ESKFGLTFDWEVEKLGVPGAIVV  114
            ***    *  **  **    * **        ** *       ****  *  *****

st-9-13-lox KNMHINEFFLKSLTLEDVPNH-GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELL  173
st-9-lox    KNTHINEFFLKSLTLEDVPNH-GKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELL  176
pd-9-lox    KNNHHSEFFLKTVTLEDVPRE-GRVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPL  175
hv-lox-a    NNYHSSEFLLKTITLHDVPGRSGNLTFVANSWIYPAANYRYSRVFFANDTYLPSQMPAAL  174
             * *  ** **  ** ***   *   *  *** **   *   * ** *   ***  *  *

st-9-13-lox RKYRENELLTLRGDGT-GKREAWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRR  232
st-9-lox    RKYRENELLTLRGDGT-GKREAWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRR  235
pd-9-lox    RKYREEELVHLRGDGK-GELQEWDRVYDYAYYNDLGNPDKGSKYARPTLGGSSGYPYPPR  234
hv-lox-a    KPYRDDELRNLRGDDQQGPYQEHDRIYRYDVYNDLGEG-------RPILGGNSDHPYPRR  227
              **  **  ****   *     ** * *  *****         *  ***    *** *

st-9-13-lox GRTGRPPTRTDPKSESRIPLILSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHA  292
st-9-lox    GRTGRPPTRTDPKSESRIPLLLSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHA  295
pd-9-lox    GRTGRPATKTDPNSESRIPLIMSLNVYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEA  294
hv-lox-a    GRTERKPNASDPSLESRLS--LLEQIYVPRDEKFGHLKTSDFLGYSIKAITQGILPAVRT  285
            *** *     **  ***         ****** ***** **** *  * * * * *    

st-9-13-lox LFDGTPNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTP  352
st-9-lox    LFDGTPNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTP  355
pd-9-lox    LFDKTPNEFDSFEDVLKLYIGGIPLPEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMP  353
hv-lox-a    YVDTTPGEFDSFQDIINLYEGGIKLPKVAALEELRKQFPLQLIKDLLPVGGDSLLKLPVP  345
              * ** ***** *   ** *** **            *           *   *  * *

st-9-13-lox LVIKDSKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIED  412
st-9-lox    LVIKDSKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIED  415
pd-9-lox    QVIEEDKSAWRTDEEFAREMLAGVNPVNISLLQEFPPASKLNPKVYGDQTSRITEQDIGN  413
hv-lox-a    HIIQENKQAWRTDEEFAREVLAGVNPVMITRLTEFPPKSSLDPSKFGDHTSTITAEHIEK  405
              *   * *********** ******  *  * **** * * *   *   * **   *  

st-9-13-lox KLDGLTVDEAMNNNKLFILNHHDVIIPYLRRIN-TTITKTYASRTLLFLQDNGSLKPLAI  471
st-9-lox    KLDGLTVDEAMNNNKLFILNHHDLLIPYLRRIN-TTITKSYASRTLLFLQDNGSLKPLAI  474
pd-9-lox    KLDGLTVHEALKQNKLFILDHHDALMPYLRRIN-STSNKIYASRTVLFLKSDGTLKPLVI  472
hv-lox-a    NLEGLTVQQALESNRLYILDHHDRFMPFLIDVNNLPGNFIYATRTLFFLRGDGRLTPLAI  465
             * ****  *   * * ** ***   * *   *       ** **  **   * * ** *

st-9-13-lox ELSLPHPDGDQFGVTSKVYTPSDQG-VESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVI  530
st-9-lox    ELSLPHPDGDQFGVTSKVYTPSDQG-VESSIWQLAKAYVAVNDAGVHQLISHWLNTHAVI  533
pd-9-lox    ELSLPHPDGDQFGRISKVYTPAEEG-VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVC  531
hv-lox-a    ELSEPIIQGGLTTAKSKVYTPVPSGSVEGWVWELAKAYVAVNDSGWHQLVSHWLNTHAVM  525
            *** *   *      ******   * **   * ********** * *** ********* 

st-9-13-lox EPFVIATNRQLSVLHPIHKLLYPHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMS  590
st-9-lox    EPFVIATNRQLSVLHPIHKLLYPHFRDTMNINASARQILINAGGVLESTVFQSKFALEMS  593
pd-9-lox    EPVVIATNRQLSVVHPIYKLLHPHFRDTMNINAFARQIVINAGGILETTVFPSRYAMELS  591
hv-lox-a    EPFVISTNRHLSVTHPVHKLLSPHYRDTMTINALARQTLINAGGIFEMTVFPGKFALGMS  585
            ** ** *** *** **  *** ** **** *** ***   ****  * ***    *   *

st-9-13-lox AVVYKDWVFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTD  650
st-9-lox    AVVYKDWVFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTD  653
pd-9-lox    SVVYKDWVFTEQALPADLIKRGVAVKDANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVED  651
hv-lox-a    AVVYKDWKFTEQGLPDDLIKRGMAVEDPSSPYKVRLLVSDYPYAADGLAIWHAIEQYVSE  645
             ****** *  * ** ** *** ** *  **   ***  ***** **  ** **   *  

st-9-13-lox YCSFYYGSDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIAS  710
st-9-lox    YCSFYYGSDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIAS  713
pd-9-lox    YCSFYYKTDDIIQEDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTAS  711
hv-lox-a    YLAIYYPNDGVLQGDTEVQAWWKETREVGHGDLKDAPWWPKMQSVPELAKACTTIIWIGS  705
            *   **  *     * * * ****  * **** *  **** *     *   ** ***  *

st-9-13-lox ALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLG  770
st-9-lox    ALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLG  773
pd-9-lox    ALHAAVNFGQFPYAGYLPNRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLG  771
hv-lox-a    ALHAAVNFGQYPYAGFLPNRPTVSRRRMPEPGTEEYAELERDPERAFIHTITSQIQTIIG  765
            ********** **** ****** **  *** **  * **   *   *  *** * **  *

st-9-13-lox VSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTN  830
st-9-lox    VSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTN  833
pd-9-lox    IALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAKIEDRITSMNNDEKLKN  831
hv-lox-a    VSLLEVLSKHSSDELYLGQRDTPEWTSDPKALEVFKRFSDRLVEIESKVVGMNHDPELKN  825
              * * ** *  ** *****  **** *   *  *  *   *  **      * *  * *

st-9-13-lox RSGPVNAPYTLLFPTS------EGGLTGKGIPNSVSI  861
st-9-lox    RSGPVNAPYTLLFPTS------EGGLTGKGIPNSVSI  864
pd-9-lox    RVGPVKMPYTLLFPTS------GGGLTGRGIPNSVSI  862
hv-lox-a    RNGPAKFPYMLLYPNTSDHKGAAAGLTAKGIPNSISI  862
            * **   ** ** *          ***  ***** ** 





Conserved Residues: 427 (min. 49.4%, max. 49.6%)