Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Plant 13-Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


pv-13-lox         -------------------MFQVPGVSGILNPGGHGHNKIKG------------------ 23
gm-lox-3          ------------------------MLGGLLHRG----HKIKG------------------ 14
ah-13-lox         -------------MVSVRRSAGIRGRAGILNRG----HKIKW------------------ 25
gm-lox-1          ----------------------------MFSAG----HKIKG------------------ 10
st-9-13-lox       ---------------------MIGQITSGLFGGHDDSKKVKG------------------ 21
st-13-lox-2       ----------MALAKEIMGISLLEKSSSFMNSSSMALFNPNNYHKENHLWFNQQFQGRR- 49
at-lox-3          ----------MALAKELMGYPLITERSSLVSSASHFKKRTQSTQFSINPFDRRPRKTKSG 50
hv-lox-1          MLTATKPLVGGACAAPSSSARRRTFVVPEARRKPGNGRRTSVSKVGSTSTSTTTTTTT-- 58
os-13-lox-2       MLTATQTLAP---AVLSRSHGAPSSFSSQPRRTAAAASRVSCTRVGALS---EVVNGE-- 52
st-13-lox         --MLKPQLQ--------QSSQSTKALIPSWNTNPLFLASFPINILNKNFRLKKKNNFR-- 48
at-lox-2          -MYCRESLSS------LQTLNVAKSLSSLFPKQSALINPISAGRRNNLPRPNLRRRCK-- 51
os-13-lox         --MLRPQLNPSSHTTTTSSSSSTQLFASSSCIASLRRPSSSSSSVVAAARRTRGQGSSR- 57


pv-13-lox         --------------TVVLMRKNVLDFNSVPDLT-KGNVGGVIGTG-----LGVVGSTVDT 63
gm-lox-3          --------------TVVLMRKNVLHVNSVT------SVGGIIGQG-----LDLVGSTLDT 49
ah-13-lox         --------------TVVLMRKNVLDVDTFTDVAATANIGGLIGTG-----INVIGSTVDA 66
gm-lox-1          --------------TVVLMPKNELEVNPD-------------------------GSAVDN 31
st-9-13-lox       --------------TVVMMNKNVLDFTDLA------------------------GSLTGK 43
st-13-lox-2       ---NLSRRKAFRQSTMAAISENLIKVVPEKAVRFKVRAVVTVRNKNKEDLKETIVKHLDA 106
at-lox-3          VVAAISEDLVKTLRFSTTTGDRKSEEEEKAAVKFKVRAVVTVRNKNKEDLKETLVKHLDA 110
hv-lox-1          -------------TLSADSNGAAVGTVTRPDVHVQDRTHATEMKATVTVHMSKAAGVRDF 105
os-13-lox-2       -------------LVVGDQEQTTDDLLTRHKNVVADYT----LSATVTVSLKQDDSTPQK 95
st-13-lox         -------------VHHNYNGASTTKAVLSSTEKATGVKAVVTVQKQVN--LNLSRG-LDD 92
at-lox-2          -------------VTASRANIEQEGNTVKEPIQNIKVKGYITAQEEFLEGITWSRG-LDD 97
os-13-lox         ------------VVVVCASSSATASRGDSSSDMAAAAAVRVKAVATIKVTVGELINRSID 105


pv-13-lox         LTAFLGRS-VSLQLISATQSDENG--KGKVGKDTFIEGIITSLPTLGAG-ESAFYVRFEW 119
gm-lox-3          LTAFLGRP-VSLQLISATKADANG--KGKLGKATFLEGIITSLPTLGAG-QSAFKINFEW 105
ah-13-lox         LTAFLGRS-VSLQLISSTQSDVNG--NGKVVKDTFLEGIIASLPTLELE-NLAFSIHFEW 122
gm-lox-1          LNAFLGRS-VSLQLISATKADAHG--KGKVGKDTFLEGINTSLPTLGAG-ESAFNIHFEW 87
st-9-13-lox       IFDVLGQK-VSFQLISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDW 102
st-13-lox-2       FTDKIGRN-VTLELISTDMDPNTK--GPKKSNQAVLKDWSKKSNLKTER--VNYTAEFIV 161
at-lox-3          FADKIGRN-IVLELISTQLDPKTK--LPKKSNAAVLKDWSKKSKTKAER--VHYTAEFTV 165
hv-lox-1          LYDLILKTWLHVDLVSSELDPQTGQEREPISGAVKHSGRVDDEWD-------MYEATFKV 158
os-13-lox-2       VADMVNRDWLFLDFFSSHIE---GMHTEPQLARYSHMD--GKGSF-------IYEASFSI 143
st-13-lox         IGDLLGKS-LLLWIVAAELDHKTGIEKP-GIRAYAHRGRDVDGDT-------HYEADFVI 143
at-lox-2          IADIRGRS-LLVELISAKTDQRITVED------YAQRVWAEAPDE-------KYECEFEM 143
os-13-lox         IRDLIGRS-LSLELVSSELDAKTGKEKATVRSYAHNVDDDDHSVV-------TYEADFDV 157
                  .     :  : . :.::                                    :   *

pv-13-lox         DGSMGIPAAFHIKNYCQVEFTSRSLTLEDVPN---QGTIRFVCNSWIYNAN---IYKKSV 173
gm-lox-3          DDGSGILGAFYIKNFMQTEFFLVSLTLEDIPN---HGSIHFVCNSWIYNAK---LFK-SD 158
ah-13-lox         DDSMGIPGAFYIKNYMQVEFFLKTLTLEDVPN---QGTIHFVCNSWVYNSK---LYK-SP 175
gm-lox-1          DGSMGIPGAFYIKNYMQVEFFLKSLTLEAISN---QGTIRFVCNSWVYNTK---LYK-SV 140
st-9-13-lox       NEEFGVPGAFIIKNMHINEFFLKSLTLEDVPN---HGKVHFVCNSWVYPSL---NYK-SD 155
st-13-lox-2       DSNFGNPGAITVTNKHQQEFFLESITIEGFA----CGPVHFPCNSWVQPKK---DHP-GK 213
at-lox-3          DAAFGSPGAITVMNKHQKEFFLESITIEGFA----LGPVHFPCNSWVQSQK---DHP-DK 217
hv-lox-1          PASFGPIGAVQVTNYHHSEMLLGDIEVFPTG--QEESAVTFHCKSWIDPS----HCTPDK 212
os-13-lox-2       PSSLDAVGAVQVVNRYSSEVYISDIDVHLCGGRHQWTDITFHCNSWID------YNPNDQ 197
st-13-lox         PQDFGEVGAILIENEHHKEMYVKNIVIDGFVH----GKVEITCNSWVHSK----FDNPDK 195
at-lox-2          PEDFGPVGAIKIQNQYHRQLFLKGVELK-LPG----GSITFTCESWVAPK----SVDPTK 194
os-13-lox         PSGFGPIGAIIVTNELRQEMFLEDINLTASDGAGNSTVLPIRCNSWVQPKSVGDEGTPSK 217
                      .  .*. : *    :.    : :           : : *:**:

pv-13-lox         RTFFANHSYVPSETPAALVHYREEELKNLRG---DGTGERVEHDRIYDYDVYNDLGNPDK 230
gm-lox-3          RIFFANQTYLPSETPAPLVKYREEELHNLRG---DGTGERKEWERVYDYDVYNDLGDPDK 215
ah-13-lox         RIFFSNKPYLPSETPAPLVKYREEDLKILRG---DGKGERQEHERIYDYDVYNDLGNPDR 232
gm-lox-1          RIFFANHTYVPSETPAPLVSYREEELKSLRG---NGTGERKEYDRIYDYDVYNDLGNPDK 197
st-9-13-lox       RIFFANQPYLPSETPELLRKYRENELLTLRG---DGTGKREAWDRIYDYDIYNDLGNPDQ 212
st-13-lox-2       RIFFSNQPYLPDETPAGLKSLRERELRDLRG---DGKGVRKLSDRIYDYDIYNDLGNPDK 270
at-lox-3          RIFFTNQPYLPNETPSGLRVLREKELKNLRG---DGSGVRKLSDRIYDFDVYNDLGNPDK 274
hv-lox-1          RVFFPAHSYLPSQTPKGVEGLRKRELEILRG---TGCGERKEHDRIYDYDVYNDLGNPDD 269
os-13-lox-2       RFFFPLKSYLPSQTPRGVKNLRKEELRAIRG---DGRGERKEWERIYDYDVYNDLGDPDN 254
st-13-lox         RIFFTNKSYLPSQTPSGVSRLREEELVTLRG---DGIGERKVFERIYDYDVYNDLGEADS 252
at-lox-2          RIFFSDKSYLPSQTPEPLKKYRKEELETLQGKNREEVGEFTKFERIYDYDVYNDVGDPD- 253
os-13-lox         RIFFANKTYLPGQTPAGLRSYRKNDLQQKRG---DGTGEREADDRVYDYDVYNDLGNPDS 274
                  * **. :.*:*.:**  :   *:.:*   :*      *     :*:**:*:***:*:.*

pv-13-lox         AA-ALARPVLGG-STLPYPRRGRTGRAKTKKETDPNSEK-----PDDFVYLPRDEAFGHL 283
gm-lox-3          GE-NHARPVLGGNDTFPYPRRGRTGRKPTRKD--PNSES-----RSNDVYLPRDEAFGHL 267
ah-13-lox         NE-NHARPILGGSTTFLTSQ-GRTGRYPARND--PNSEK-----PGDVY-VPRDENFGHL 282
gm-lox-1          SE-KLARPVLGGSSTFPYPRRGRTGRGPTVTD--PNTEK-----QGEVFYVPRDENLGHL 249
st-9-13-lox       GK-ENVRTTLGGSAEYPYPRRGRTGRPPTRTD--PKSESRIPLILSLDIYVPRDERFGHL 269
st-13-lox-2       GI-DFARPKLGGDDNVPYPRRCRSGRVPTDTDISAESRVE----KPNPTYVPRDEQFEES 325
at-lox-3          SS-ELSRPKLGGKE-VPYPRRCRTGRQSTVSDKDAESRVE----KPLPMYVPRDEQFEES 328
hv-lox-1          DNNPTTRPVLGG-KEHPYPRRCRTGRPRSKKD--PFSEER-SHKE--HIYVPRDEAFTER 323
os-13-lox-2       DP-ATRRPVLGG-RGRPYPRRCRTGRRRCRTD--PSSESP-PAKDGAGIYVPRDEAFTER 309
st-13-lox         NNDDAKRPVLGG-KELPYPRRCKTGRPRSKKD--PLSE----TRS-TFVYVPRDEAFSEV 304
at-lox-2          NDPELARPVIGG-LTHPYPRRCKTGRKPCETD--PSSE----QRYGGEFYVPRDEEFSTA 306
os-13-lox         NG-DLARPVLGGNKQFPYPRRCRTGRPPSKKD--PKSE----TRK-GNVYVPRDEEFSPE 326
                        *. :**      .:  ::**    .:  . :.            :**** :

pv-13-lox         KSSDFLAYALKSVSQDVLPVLTDAFDGSL-LSLEFDNFAEVHKLYDGGVTLPT----GFL 338
gm-lox-3          KSSDFLTYGLKSVSQNVLPLLQSAFDLNF-TPREFDSFDEVHGLYSGGIKLPT----DII 322
ah-13-lox         KSSDFLANSIKFLTRYVLPAFESVFDLNL-TPNEFDSFQDVRDLYEGGIRLPT----EVI 337
gm-lox-1          KSKDALEIGTKSLSQIVQPAFESAFDLKS-TPIEFHSFQDVHDLYEGGIKLPR----DVI 304
st-9-13-lox       KMSDFLTYALKSIVQFILPELHALFDG---TPNEFDSFEDVLRLYEGGIKLPQGPLFKAL 326
st-13-lox-2       KMNTFSTSRLKAVLHNLIPSLMASISSN---NHDFKGFSDIDNLYSKGLLLKLGLQDEVL 382
at-lox-3          KQDTFAAGRLKAVLHHLIPSLKASIVA-----EDFADFGEIDRLYKEGLLPKLGFQDDIF 383
hv-lox-1          KMGAFDTKKFMSQLHALTTGLK-TAKHK---SQSFPSLSAIDQLYDDNFRNQP--VQPEG 377
os-13-lox-2       KAGAFATKKALSALSAFTTAQR-VSGDR---RRGFPSLAAIDALYEDGYKNRPSSSQQEA 365
st-13-lox         KSVAFSGNTVYSVLHAVVPALESVVTDP---NLGFPHFPAIDSLFNVG-VDLPGLGDKKS 360
at-lox-2          KGTSFTGKAVLAALPSIFPQIESVLLSP---QEPFPHFKAIQNLFEEG-IQLP----KDA 358
os-13-lox         KEDYFLRKTVGSVLQAAVPAAQSCSSDKLKWNLPFPSFFVIDKLFEDG-VELP-----GV 380
                  *                 .               *  :  :  *:. .

pv-13-lox         SKYA------PIPIVKEIFRSD-------GEQFLKYPPPKVMQVD--KSAWMTDEEFARE 383
gm-lox-3          SKIS------PLPVLKEIFRTD-------GEQALKFPPPKVIQVS--KSAWMTDEEFARE 367
ah-13-lox         STKR------RLLVIKELFRTD-------GEQVLKFPPPRFLQVNEENSAWMTDEEFV-- 382
gm-lox-1          STII------PLPVIKELYRTD-------GQHILKFPQPHVVQVS--QSAWMTDEEFARE 349
st-9-13-lox       TAAI------PLEMIRELLRTD-------GEGILRFPTPLVIKDS--KTAWRTDEEFARE 371
st-13-lox-2       KKLP------LPKVVSSIKEG----------DLLKYDTPKILSKD--KFAWLRDDEFARQ 424
at-lox-3          KKFP------LPKVVVDTLQES-------TKGLLKYDTPKILSKD--KNAWLRDDEFARQ 428
hv-lox-1          GKLR-FVIDLLETELLHLFKLEGAAFLEGIRRVFKFETPEIHDRD--KFAWFRDEEFARQ 434
os-13-lox-2       DNLEGYFREVLQKQVKLLLKGEKEEFKEELRKVFKFQTPEIHDKD--KLAWFRDEEFARQ 423
st-13-lox         GLFN-----VVPRLIKAIS--------DTRKDVLLFESPQLVQRD--KFSWFRDVEFARQ 405
at-lox-2          GLLP-----LLPRIIKALG--------EAQDDILQFDAPVLINRD--RFSWLRDDEFARQ 403
os-13-lox         DKLN-FLESVVPRLLEHLR-------DTPAEKILRFETPANIQKD--KFAWLRDEEFARE 430
                                :                  : :  *   . .  . :*  * **.

pv-13-lox         TIAGVNPNVIKIL--KEFPPRSTLDTQAYGDHTSIITKEHLEPKLGG-LTVEQAIENKKL 440
gm-lox-3          MLAGVNPNLIRCL--KEFPPRSKLDSQVYGDHTSQITKEHLEPNLEG-LTVDEAIQNKRL 424
ah-13-lox         --------IIN----ELLVSHPCMDPTIYGDQNSKIPAEVLD--LEG-CSLEEAINGRRL 427
gm-lox-1          MIAGVNPCVIRGL--EEFPPKSNLDPAIYGDQSSKITADSLD--LDG-YTMDEALGSRRL 404
st-9-13-lox       MLAGVNPIIISRL--QEFPPKSKLDPEAYGNQNSTITAEHIEDKLDG-LTVDEAMNNNKL 428
st-13-lox-2       AIAGVNPVSIEKL--QFFPPVSKLDPEIYGPQESALKEEHILGHLNG-MTVQEALDANKL 481
at-lox-3          AIAGINPVNIERV--KTFPPVSNLDPKIYGPQHSALTDDHIIGHLDG-FSVQQALEENRL 485
hv-lox-1          TIAGMNPMSIQLV--TEFPIKSNLDEATYGPADSLITKEVVEEQIRRVMTADEAVQNKKL 492
os-13-lox-2       TLAGMNPLSIQLVRDTDFPIFSKLDEETYGPGDSLITKELIEEQINGVMTAEEAVEKKKL 483
st-13-lox         TLAGLNPYSIRLV--TEWPLRSKLDPKVYGPPESEITKELIEKEIGNYMTVEQAVQQKKL 463
at-lox-2          TLAGLNPYSIQLV--EEWPLISKLDPAVYGDPTSLITWEIVEREVKGNMTVDEALKNKRL 461
os-13-lox         TLAGINPYAIELVR--EFPLKSKLDPAVYGPAESAITADLLEEQMRRVMTVEEAINQKRL 488
                           *           . :*   **   * :  : :   :    : ::*:  .:*

pv-13-lox         FILDHHDYLIPYLRRINSS-TTKTYATRTIFFLKDDGTLAPLAIELSKPHSQGDEHGPVS 499
gm-lox-3          FLLGHHDPIMPYLRRINAT-STKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFS 483
ah-13-lox         FILDYHDVFMPYVRRINET-HAKAYATRTILFLKEDGTLNPVAIELSLPHPDGDKSGAIS 486
gm-lox-1          FMLDYHDIFMPYVRQINQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVS 464
st-9-13-lox       FILNHHDVIIPYLRRINTT-ITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTS 487
st-13-lox-2       FIVDHHDVYLPFLDRINALDGRKAYATRTIFFLSDVGTLKPIAIELSLPQTG--PSSRSK 539
at-lox-3          YMLDYHDIFLPFLDRINALDGRKAYATRTIFFLTRLGTLKPVAIELSLPPHG--PKHRSK 543
hv-lox-1          FMLDYHDLLLPYVHKVRKLDGTTLYGSRALFFLTADGTLRPIAIELTRPKSK--KKPQWR 550
os-13-lox-2       FMLDYHDVLLPFVHAVRELDDTTLYASRTLFFLTEDGTLRPIAIELTRPKSP--NTPQWR 541
st-13-lox         FILDYHDLLLPYVNKVNELKGSMLYGSRTIFFLTPQGTLKPLAIELTRPPVD--DKPQWK 521
at-lox-2          FVLDYHDLLLPYVNKVRELNNTTLYASRTLFFLSDDSTLRPVAIELTCPPNI--NKPQWK 519
os-13-lox         FMLDFHDLFLPYVHKIRSLDHTTMYGSRTVFFLTDDGTLQLLAIELTRPASL--SQPQWR 546
                  :::..**  :*::  :.       *.:*:::**   .:*  :****: *

pv-13-lox         EVYVPAY--EGVEAYIWLLAKAYVVVNDSCYHQIVSHWLNTHAVVEPFVIATNRQLSVVH 557
gm-lox-3          QVFLPAD--EGVESSIWLLAKAYVVVNDSCYHQLVSHWLNTHAVVEPFIIATNRHLSVVH 541
ah-13-lox         DVILPAK--GRCRKHNLATSQSLCHINDSCYHHLMSHWLNTHAVIEPFVIATNRQLSVIH 544
gm-lox-1          QVVLPAK--EGVESTIWLLAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLH 522
st-9-13-lox       KVYTPSD--QGVESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVIEPFVIATNRQLSVLH 545
st-13-lox-2       RVVTPPV--CATGNWTWQIAKAHVCANDAGVHQLVNHWLRTHASLEPFILAAHRQLSAMH 597
at-lox-3          RVLTPPV--DATSNWMWQLAKAHVSSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMH 601
hv-lox-1          QVFTPGCDGSVTGSWLWQLAKAHILAHDAGVHQLVSHWLRTHACTEPYIIAANRQLSQMH 610
os-13-lox-2       QVFTPGS--SVAASWLWQLAKTHVLAHDTGYHQLVSHWLRTHCCVEPYVIAANRRLSQMH 599
st-13-lox         EVYSPND-WNATGAWLWKLAKAHVLSHDSGYHQLVSHWLRTHCCTEPYIIASNRQLSAMH 580
at-lox-2          QVFTPG--YDATSCWLWNLAKTHAISHDAGYHQLISHWL--------------------- 556
os-13-lox         QVFTPST--DATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMH 604
                   *  *              :::    :*:  *.::.***

pv-13-lox         PVYKLLFPHYRDTMNINSLARKSLVNADGIIEKTFLWSRYSMEMSSVIYKD-WSLVDQAL 616
gm-lox-3          PIYKLLHPHYRDTMNINGLARLSLVNDGGVIEQTFLWGRYSVEMSAVVYKD-WVFTDQAL 600
ah-13-lox         PIYKLLSPHYRDTMNINALARQNLINSDGIIERTFLPSKFSVEMSSAVYKN-WVFTDQAL 603
gm-lox-1          PIYKLLTPHYRNNMNINALARQSLINANGIIETTFLPSKYSVEMSSAVYKN-WVFTDQAL 581
st-9-13-lox       PIHKLLYPHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMSAVVYKD-WVFPDQAL 604
st-13-lox-2       PIYKLLDPHMRYTLEINGLARQSLINADGVIEACFTPGRYCMEISAAAYKN-WRFDLEGL 656
at-lox-3          PIFKLLDPHMRYTLEINALARQSLISADGVIEGGFTAGAYGMEMSAAAYKSSWRFDMEGL 661
hv-lox-1          PVYRLLHPHFRFTMEINAQARAMLINAGGIIEGSFVPGEYSLELSSVAYDQQWRFDMEAL 670
os-13-lox-2       PIYRLLHPHFRFTMEINAQARGMLINANGIIESAFAPGKLCMELSSAVYDKFWRFDMEAL 659
st-13-lox         PIYRLLHPHFRYTMEINALAREALINANGVIESSFFPGKYAIELSSIAYGAEWRFDQEAL 640
at-lox-2          -----LHPHFRYTMEINARARQSLVNGGGIIETCFWPGKYALELSSAVYGKLWRFDQEGL 611
os-13-lox         PIYQLLRPHFRYTMRINARA-ARVISAGGIIERSFSPQKYSMELSSVAYDKLWRFDTEAL 663
                       * ** * .:.**. *   ::. .*::*  .      :*:*:  *   * :  :.*

pv-13-lox         PNDLIKRGVAVADPSAPHGVKLVIEDYPYASDGLEIWDAIKSWVEEYVAFYYKSDEALQK 676
gm-lox-3          PADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLRE 660
ah-13-lox         PADLIKRGMAVEDSSSPYGIRLVIEDYPYAVDGLEIWFAIKEWVQDYVSLYYPTDNDLKK 663
gm-lox-1          PADLIKRGVAIKDPSTPHGVRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKN 641
st-9-13-lox       PADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILK 664
st-13-lox-2       PADLIRRGMAVPDSTQPHGLKLLIEDYPYAADGLMIWGAIESWVRDYVNHYYPSSAQVCS 716
at-lox-3          PADLIRRGMAIPDATQPHGLKLLIEDYPYANDGLLLWSAIQTWVRTYVERYYPNPNLIKT 721
hv-lox-1          PEDLIRRGMAVRNPNG--ELELAIEDYPYANDGLLVWDAIKQWALTYVQHYYPCAADIVD 728
os-13-lox-2       PADLIRRGMAIECEDG--KLELTIEDYPYANDGLLIWDSIKEWVSDYVNHYYQLASDIHM 717
st-13-lox         PQNLISRGLAVEDPNEPHGLKLAIEDYPFANDGLVLWDILKQWVTNYVNHYYPQTNLIES 700
at-lox-2          PADLIKRGLAEEDKTAEHGVRLTIPDYPFANDGLILWDAIKEWVTDYVKHYYPDEELITS 671
os-13-lox         PADLVRRGMAEEDPTAEQGLKLAIEDYPFANDGLLIWDAIKTWVQAYVARFYPDADSVAG 723
                  * :*: **:*         :.* * ***:* *** :*  :: *.  *   :*     :

pv-13-lox         DPELQAWWKELVQVGHGDLKDKPWWPKMQSRGDLVAVSTTLIWIASALHAAVNFGQYPLG 736
gm-lox-3          DPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAIIIWTASALHAAVNFGQYPYG 720
ah-13-lox         DPELQNWWKEAVEVGHGDLKDKPWWPKMQTVEELVESCTTIIWTASALHAAVNFGQYPYG 723
gm-lox-1          DSELQHWWKEAVEKGHGDLKDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYG 701
st-9-13-lox       DNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQYPYA 724
st-13-lox-2       DRELQAWYAETINVGHVDLRNEEWWPTLATPEDLISILTTLIWLASAQHAALNFGQYPYG 776
at-lox-3          DSELQSWYSESINVGHADLRDADWWPELSTVDDLVSILTTLIWLASAQHAALNFGQYPYG 781
hv-lox-1          DEELQAWWTEVRTKGHADKQDEPWWPELDSHENLAQTLATIMWVTSGHHAAVNFGQYPMA 788
os-13-lox-2       DKELQGWWNEVRTKGHPDKEEG--WPELNCHGSLVEVLTTIIWVASGHHAAVNFGQYPYA 775
st-13-lox         DKELQAWWSEIKNVGHGDKRDEPWWPELKTPNDLIGIITTIVWVTSGHHAAVNFGQYSYA 760
at-lox-2          DEELQGWWSEVRNIGHGDKKDEPWWPVLKTQDDLIGVVTTIAWVTSGHHAAVNFGQYGYG 731
os-13-lox         DEELQAFWTEVRTKGHGDKKDAPWWPKLDSPESLAHTLTNIVWVAAAHHAAVNFGQYDFG 783
                  * ***  : *    ** * .:   ** :    .*      : * ::. ***:*****  .

pv-13-lox         GLILNRPTISRRFMPVEG-----SAEYAALAKNPEKEFLRTITGKKETLIDLTVIEILSR 791
gm-lox-3          GLILNRPTLSRRFMPEKG-----SAEYEELRKNPQKAYLKTITPKFQTLIDLSVIEILSR 775
ah-13-lox         GLILNRPTLSRRLLPEQG-----TAEYEEMVKSHQKAYLRTITPKLETLIDLTTIEILSK 778
gm-lox-1          GLIMNRPTASRRLLPEKG-----TPEYEEMINNHEKAYLRTITSKLPTLISLSVIEILST 756
st-9-13-lox       GYLPNRPTVSRRFMPEPG-----TPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSR 779
st-13-lox-2       GYVPNRPPLMRRLIPDEN-----DPEYAVFLADPQKYFFSALPSLLQATKFMAVVDTLST 831
at-lox-3          GYVPNRPPLMRRLIPDES-----DPEYASFISHPEKYYFSSMPSLAQTSKFMAVVDTLST 836
hv-lox-1          GYIPNRPTMARRNMPTE---IGGDDMR-DFVEAPEKVLLDTFPSQYQSAIVLAILDLLST 844
os-13-lox-2       GYFPNRPTIARRNMPTEGQACSHDGMQPTFVEDPVRVLLDTFPSQYQTTLVLPVLNLLSS 835
st-13-lox         GYFPNRPTVARSKMPTED---PTAEEWEWFMNKPEEALLRCFPSQIQATKVMAILDVLSN 817
at-lox-2          GYFPNRPTTTRIRMPTED---PTDEALKEFYESPEKVLLKTYPSQKQATLVMVTLDLLST 788
os-13-lox         GYFPNRPSIARTVMPVEEP--VDGAAMERFLDNPDQALRECFPSQVQATVVMAVLDVLSS 841
                  * . ***.  *  :*              :     .      .    :   :  :: **

pv-13-lox         HASDEIYLGERDGGDHWTSDAGPLEAFKRFGKKLAEIEEKLVKKNNDETLR-NRTGPAKM 850
gm-lox-3          HASDEVYLGERDN-PNWTSDTRALEAFKRFGNKLAQIENKLSERNNDEKLR-NRCGPVQM 833
ah-13-lox         HASDEVYLGERDN-PHWTFDSRALEAFQRFGNKLSEIEEKLTEKNKDGRLS-NRIGPVEL 836
gm-lox-1          HASDEVYLGQRDN-PHWTSDSKALQAFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQL 815
st-9-13-lox       HTTDEIYLGQRES-PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILT-NRSGPVNA 837
st-13-lox-2       HSPDEEYLGERHQPSTWTGDAEIVEAFYKFSAEIGRIEKEIDERNANTKLK-NRCGAGVL 890
at-lox-3          HSPDEEYIGERQQPSIWTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRR-NRCGAGVL 895
hv-lox-1          HSSDEEYMGTHEE-PAWTKDGVINQAFEEFKESTRKIVEQVDEWNNDPDRK-NRHGAGMV 902
os-13-lox-2       HSPGEEYMGTHAE-SAWMADREVRAAFGRFNERMMSIAEMIDCRNKDPERK-NRQGPGVV 893
st-13-lox         HSPDEEYIGEKIE-PYWAEDPVINAAFEVFSGKLKELEGIIDARNNDSKLS-NRNGAGVM 875
at-lox-2          HSPDEEYIGEQQE-ASWANEPVINAAFERFKGKLQYLEGVIDERNVNITLK-NRAGAGVV 846
os-13-lox         HSTDEEYLGGEQT-RPGTATRRLQAAYDGFAARLKEIEGVIDGRNKDRKLK-NRCGAGIL 899
                  *:..* *:* .              *:  *      :   :   * :     ** *.

pv-13-lox         PYTLLYPSS----------EEGLTFRGIPNSISI 874
gm-lox-3          PYTLLLPSS----------KEGLTFRGIPNSISI 857
ah-13-lox         PYTLLHPTS----------NEGLTFRGVPNSISI 860
gm-lox-1          PYTLLYPSS----------EEGLTFRGIPNSISI 839
st-9-13-lox       PYTLLFPTS----------EGGLTGKGIPNSVSI 861
st-13-lox-2       PYELLAPSS----------GPGVTCRGVPNSVSI 914
at-lox-3          PYELLVPSS----------EPGVTCRGVPNSVSI 919
hv-lox-1          PYVLLRPSDGDPTDGDPTDEKMVMEMGIPNSISI 936
os-13-lox-2       PYVLLKPSYGDPKD-----MTSVMEMGIPNSISI 922
st-13-lox         PYELLKPYS----------EPGVTGKGVPYSISI 899
at-lox-2          KYELLKPTS----------EHGVTGMGVPYSISI 870
os-13-lox         PYQLMKPFS----------DSGVTGMGIPNSTSI 923
                   * *: *               :   *:* * **