Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Plant 13-Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

pv-13-lox   -------------------MFQVPGVSGILNPGGHGHNKIKG------------------   23
gm-lox-3    ------------------------MLGGLLHRG----HKIKG------------------   14
ah-13-lox   -------------MVSVRRSAGIRGRAGILNRG----HKIKW------------------   25
gm-lox-1    ----------------------------MFSAG----HKIKG------------------   10
st-9-13-lox ---------------------MIGQITSGLFGGHDDSKKVKG------------------   21
st-13-lox-2 ----------MALAKEIMGISLLEKSSSFMNSSSMALFNPNNYHKENHLWFNQQFQGRR-   49
at-lox-3    ----------MALAKELMGYPLITERSSLVSSASHFKKRTQSTQFSINPFDRRPRKTKSG   50
hv-lox-1    MLTATKPLVGGACAAPSSSARRRTFVVPEARRKPGNGRRTSVSKVGSTSTSTTTTTTT--   58
os-13-lox-2 MLTATQTLAP---AVLSRSHGAPSSFSSQPRRTAAAASRVSCTRVGALS---EVVNGE--   52
st-13-lox   --MLKPQLQ--------QSSQSTKALIPSWNTNPLFLASFPINILNKNFRLKKKNNFR--   48
at-lox-2    -MYCRESLSS------LQTLNVAKSLSSLFPKQSALINPISAGRRNNLPRPNLRRRCK--   51
os-13-lox   --MLRPQLNPSSHTTTTSSSSSTQLFASSSCIASLRRPSSSSSSVVAAARRTRGQGSSR-   57
                                                                        

pv-13-lox   --------------TVVLMRKNVLDFNSVPDLT-KGNVGGVIGTG-----LGVVGSTVDT   63
gm-lox-3    --------------TVVLMRKNVLHVNSVT------SVGGIIGQG-----LDLVGSTLDT   49
ah-13-lox   --------------TVVLMRKNVLDVDTFTDVAATANIGGLIGTG-----INVIGSTVDA   66
gm-lox-1    --------------TVVLMPKNELEVNPD-------------------------GSAVDN   31
st-9-13-lox --------------TVVMMNKNVLDFTDLA------------------------GSLTGK   43
st-13-lox-2 ---NLSRRKAFRQSTMAAISENLIKVVPEKAVRFKVRAVVTVRNKNKEDLKETIVKHLDA  106
at-lox-3    VVAAISEDLVKTLRFSTTTGDRKSEEEEKAAVKFKVRAVVTVRNKNKEDLKETLVKHLDA  110
hv-lox-1    -------------TLSADSNGAAVGTVTRPDVHVQDRTHATEMKATVTVHMSKAAGVRDF  105
os-13-lox-2 -------------LVVGDQEQTTDDLLTRHKNVVADYT----LSATVTVSLKQDDSTPQK   95
st-13-lox   -------------VHHNYNGASTTKAVLSSTEKATGVKAVVTVQKQVN--LNLSRG-LDD   92
at-lox-2    -------------VTASRANIEQEGNTVKEPIQNIKVKGYITAQEEFLEGITWSRG-LDD   97
os-13-lox   ------------VVVVCASSSATASRGDSSSDMAAAAAVRVKAVATIKVTVGELINRSID  105
                                                                        

pv-13-lox   LTAFLGRS-VSLQLISATQSDENG--KGKVGKDTFIEGIITSLPTLGAG-ESAFYVRFEW  119
gm-lox-3    LTAFLGRP-VSLQLISATKADANG--KGKLGKATFLEGIITSLPTLGAG-QSAFKINFEW  105
ah-13-lox   LTAFLGRS-VSLQLISSTQSDVNG--NGKVVKDTFLEGIIASLPTLELE-NLAFSIHFEW  122
gm-lox-1    LNAFLGRS-VSLQLISATKADAHG--KGKVGKDTFLEGINTSLPTLGAG-ESAFNIHFEW   87
st-9-13-lox IFDVLGQK-VSFQLISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDW  102
st-13-lox-2 FTDKIGRN-VTLELISTDMDPNTK--GPKKSNQAVLKDWSKKSNLKTER--VNYTAEFIV  161
at-lox-3    FADKIGRN-IVLELISTQLDPKTK--LPKKSNAAVLKDWSKKSKTKAER--VHYTAEFTV  165
hv-lox-1    LYDLILKTWLHVDLVSSELDPQTGQEREPISGAVKHSGRVDDEWD-------MYEATFKV  158
os-13-lox-2 VADMVNRDWLFLDFFSSHIE---GMHTEPQLARYSHMD--GKGSF-------IYEASFSI  143
st-13-lox   IGDLLGKS-LLLWIVAAELDHKTGIEKP-GIRAYAHRGRDVDGDT-------HYEADFVI  143
at-lox-2    IADIRGRS-LLVELISAKTDQRITVED------YAQRVWAEAPDE-------KYECEFEM  143
os-13-lox   IRDLIGRS-LSLELVSSELDAKTGKEKATVRSYAHNVDDDDHSVV-------TYEADFDV  157
                                                                     *  

pv-13-lox   DGSMGIPAAFHIKNYCQVEFTSRSLTLEDVPN---QGTIRFVCNSWIYNAN---IYKKSV  173
gm-lox-3    DDGSGILGAFYIKNFMQTEFFLVSLTLEDIPN---HGSIHFVCNSWIYNAK---LFK-SD  158
ah-13-lox   DDSMGIPGAFYIKNYMQVEFFLKTLTLEDVPN---QGTIHFVCNSWVYNSK---LYK-SP  175
gm-lox-1    DGSMGIPGAFYIKNYMQVEFFLKSLTLEAISN---QGTIRFVCNSWVYNTK---LYK-SV  140
st-9-13-lox NEEFGVPGAFIIKNMHINEFFLKSLTLEDVPN---HGKVHFVCNSWVYPSL---NYK-SD  155
st-13-lox-2 DSNFGNPGAITVTNKHQQEFFLESITIEGFA----CGPVHFPCNSWVQPKK---DHP-GK  213
at-lox-3    DAAFGSPGAITVMNKHQKEFFLESITIEGFA----LGPVHFPCNSWVQSQK---DHP-DK  217
hv-lox-1    PASFGPIGAVQVTNYHHSEMLLGDIEVFPTG--QEESAVTFHCKSWIDPS----HCTPDK  212
os-13-lox-2 PSSLDAVGAVQVVNRYSSEVYISDIDVHLCGGRHQWTDITFHCNSWID------YNPNDQ  197
st-13-lox   PQDFGEVGAILIENEHHKEMYVKNIVIDGFVH----GKVEITCNSWVHSK----FDNPDK  195
at-lox-2    PEDFGPVGAIKIQNQYHRQLFLKGVELK-LPG----GSITFTCESWVAPK----SVDPTK  194
os-13-lox   PSGFGPIGAIIVTNELRQEMFLEDINLTASDGAGNSTVLPIRCNSWVQPKSVGDEGTPSK  217
                    *    *                            * **              

pv-13-lox   RTFFANHSYVPSETPAALVHYREEELKNLRG---DGTGERVEHDRIYDYDVYNDLGNPDK  230
gm-lox-3    RIFFANQTYLPSETPAPLVKYREEELHNLRG---DGTGERKEWERVYDYDVYNDLGDPDK  215
ah-13-lox   RIFFSNKPYLPSETPAPLVKYREEDLKILRG---DGKGERQEHERIYDYDVYNDLGNPDR  232
gm-lox-1    RIFFANHTYVPSETPAPLVSYREEELKSLRG---NGTGERKEYDRIYDYDVYNDLGNPDK  197
st-9-13-lox RIFFANQPYLPSETPELLRKYRENELLTLRG---DGTGKREAWDRIYDYDIYNDLGNPDQ  212
st-13-lox-2 RIFFSNQPYLPDETPAGLKSLRERELRDLRG---DGKGVRKLSDRIYDYDIYNDLGNPDK  270
at-lox-3    RIFFTNQPYLPNETPSGLRVLREKELKNLRG---DGSGVRKLSDRIYDFDVYNDLGNPDK  274
hv-lox-1    RVFFPAHSYLPSQTPKGVEGLRKRELEILRG---TGCGERKEHDRIYDYDVYNDLGNPDD  269
os-13-lox-2 RFFFPLKSYLPSQTPRGVKNLRKEELRAIRG---DGRGERKEWERIYDYDVYNDLGDPDN  254
st-13-lox   RIFFTNKSYLPSQTPSGVSRLREEELVTLRG---DGIGERKVFERIYDYDVYNDLGEADS  252
at-lox-2    RIFFSDKSYLPSQTPEPLKKYRKEELETLQGKNREEVGEFTKFERIYDYDVYNDVGDPD-  253
os-13-lox   RIFFANKTYLPGQTPAGLRSYRKNDLQQKRG---DGTGEREADDRVYDYDVYNDLGNPDS  274
            * **    * *  **      *   *    *      *      * ** * *** *  * 

pv-13-lox   AA-ALARPVLGG-STLPYPRRGRTGRAKTKKETDPNSEK-----PDDFVYLPRDEAFGHL  283
gm-lox-3    GE-NHARPVLGGNDTFPYPRRGRTGRKPTRKD--PNSES-----RSNDVYLPRDEAFGHL  267
ah-13-lox   NE-NHARPILGGSTTFLTSQ-GRTGRYPARND--PNSEK-----PGDVY-VPRDENFGHL  282
gm-lox-1    SE-KLARPVLGGSSTFPYPRRGRTGRGPTVTD--PNTEK-----QGEVFYVPRDENLGHL  249
st-9-13-lox GK-ENVRTTLGGSAEYPYPRRGRTGRPPTRTD--PKSESRIPLILSLDIYVPRDERFGHL  269
st-13-lox-2 GI-DFARPKLGGDDNVPYPRRCRSGRVPTDTDISAESRVE----KPNPTYVPRDEQFEES  325
at-lox-3    SS-ELSRPKLGGKE-VPYPRRCRTGRQSTVSDKDAESRVE----KPLPMYVPRDEQFEES  328
hv-lox-1    DNNPTTRPVLGG-KEHPYPRRCRTGRPRSKKD--PFSEER-SHKE--HIYVPRDEAFTER  323
os-13-lox-2 DP-ATRRPVLGG-RGRPYPRRCRTGRRRCRTD--PSSESP-PAKDGAGIYVPRDEAFTER  309
st-13-lox   NNDDAKRPVLGG-KELPYPRRCKTGRPRSKKD--PLSE----TRS-TFVYVPRDEAFSEV  304
at-lox-2    NDPELARPVIGG-LTHPYPRRCKTGRKPCETD--PSSE----QRYGGEFYVPRDEEFSTA  306
os-13-lox   NG-DLARPVLGGNKQFPYPRRCRTGRPPSKKD--PKSE----TRK-GNVYVPRDEEFSPE  326
                  *   **            **                         ****     

pv-13-lox   KSSDFLAYALKSVSQDVLPVLTDAFDGSL-LSLEFDNFAEVHKLYDGGVTLPT----GFL  338
gm-lox-3    KSSDFLTYGLKSVSQNVLPLLQSAFDLNF-TPREFDSFDEVHGLYSGGIKLPT----DII  322
ah-13-lox   KSSDFLANSIKFLTRYVLPAFESVFDLNL-TPNEFDSFQDVRDLYEGGIRLPT----EVI  337
gm-lox-1    KSKDALEIGTKSLSQIVQPAFESAFDLKS-TPIEFHSFQDVHDLYEGGIKLPR----DVI  304
st-9-13-lox KMSDFLTYALKSIVQFILPELHALFDG---TPNEFDSFEDVLRLYEGGIKLPQGPLFKAL  326
st-13-lox-2 KMNTFSTSRLKAVLHNLIPSLMASISSN---NHDFKGFSDIDNLYSKGLLLKLGLQDEVL  382
at-lox-3    KQDTFAAGRLKAVLHHLIPSLKASIVA-----EDFADFGEIDRLYKEGLLPKLGFQDDIF  383
hv-lox-1    KMGAFDTKKFMSQLHALTTGLK-TAKHK---SQSFPSLSAIDQLYDDNFRNQP--VQPEG  377
os-13-lox-2 KAGAFATKKALSALSAFTTAQR-VSGDR---RRGFPSLAAIDALYEDGYKNRPSSSQQEA  365
st-13-lox   KSVAFSGNTVYSVLHAVVPALESVVTDP---NLGFPHFPAIDSLFNVG-VDLPGLGDKKS  360
at-lox-2    KGTSFTGKAVLAALPSIFPQIESVLLSP---QEPFPHFKAIQNLFEEG-IQLP----KDA  358
os-13-lox   KEDYFLRKTVGSVLQAAVPAAQSCSSDKLKWNLPFPSFFVIDKLFEDG-VELP-----GV  380
            *                                 *        *                

pv-13-lox   SKYA------PIPIVKEIFRSD-------GEQFLKYPPPKVMQVD--KSAWMTDEEFARE  383
gm-lox-3    SKIS------PLPVLKEIFRTD-------GEQALKFPPPKVIQVS--KSAWMTDEEFARE  367
ah-13-lox   STKR------RLLVIKELFRTD-------GEQVLKFPPPRFLQVNEENSAWMTDEEFV--  382
gm-lox-1    STII------PLPVIKELYRTD-------GQHILKFPQPHVVQVS--QSAWMTDEEFARE  349
st-9-13-lox TAAI------PLEMIRELLRTD-------GEGILRFPTPLVIKDS--KTAWRTDEEFARE  371
st-13-lox-2 KKLP------LPKVVSSIKEG----------DLLKYDTPKILSKD--KFAWLRDDEFARQ  424
at-lox-3    KKFP------LPKVVVDTLQES-------TKGLLKYDTPKILSKD--KNAWLRDDEFARQ  428
hv-lox-1    GKLR-FVIDLLETELLHLFKLEGAAFLEGIRRVFKFETPEIHDRD--KFAWFRDEEFARQ  434
os-13-lox-2 DNLEGYFREVLQKQVKLLLKGEKEEFKEELRKVFKFQTPEIHDKD--KLAWFRDEEFARQ  423
st-13-lox   GLFN-----VVPRLIKAIS--------DTRKDVLLFESPQLVQRD--KFSWFRDVEFARQ  405
at-lox-2    GLLP-----LLPRIIKALG--------EAQDDILQFDAPVLINRD--RFSWLRDDEFARQ  403
os-13-lox   DKLN-FLESVVPRLLEHLR-------DTPAEKILRFETPANIQKD--KFAWLRDEEFARE  430
                                                  *           *  * **   

pv-13-lox   TIAGVNPNVIKIL--KEFPPRSTLDTQAYGDHTSIITKEHLEPKLGG-LTVEQAIENKKL  440
gm-lox-3    MLAGVNPNLIRCL--KEFPPRSKLDSQVYGDHTSQITKEHLEPNLEG-LTVDEAIQNKRL  424
ah-13-lox   --------IIN----ELLVSHPCMDPTIYGDQNSKIPAEVLD--LEG-CSLEEAINGRRL  427
gm-lox-1    MIAGVNPCVIRGL--EEFPPKSNLDPAIYGDQSSKITADSLD--LDG-YTMDEALGSRRL  404
st-9-13-lox MLAGVNPIIISRL--QEFPPKSKLDPEAYGNQNSTITAEHIEDKLDG-LTVDEAMNNNKL  428
st-13-lox-2 AIAGVNPVSIEKL--QFFPPVSKLDPEIYGPQESALKEEHILGHLNG-MTVQEALDANKL  481
at-lox-3    AIAGINPVNIERV--KTFPPVSNLDPKIYGPQHSALTDDHIIGHLDG-FSVQQALEENRL  485
hv-lox-1    TIAGMNPMSIQLV--TEFPIKSNLDEATYGPADSLITKEVVEEQIRRVMTADEAVQNKKL  492
os-13-lox-2 TLAGMNPLSIQLVRDTDFPIFSKLDEETYGPGDSLITKELIEEQINGVMTAEEAVEKKKL  483
st-13-lox   TLAGLNPYSIRLV--TEWPLRSKLDPKVYGPPESEITKELIEKEIGNYMTVEQAVQQKKL  463
at-lox-2    TLAGLNPYSIQLV--EEWPLISKLDPAVYGDPTSLITWEIVEREVKGNMTVDEALKNKRL  461
os-13-lox   TLAGINPYAIELVR--EFPLKSKLDPAVYGPAESAITADLLEEQMRRVMTVEEAINQKRL  488
                     *              *   **   *                   *     *

pv-13-lox   FILDHHDYLIPYLRRINSS-TTKTYATRTIFFLKDDGTLAPLAIELSKPHSQGDEHGPVS  499
gm-lox-3    FLLGHHDPIMPYLRRINAT-STKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFS  483
ah-13-lox   FILDYHDVFMPYVRRINET-HAKAYATRTILFLKEDGTLNPVAIELSLPHPDGDKSGAIS  486
gm-lox-1    FMLDYHDIFMPYVRQINQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVS  464
st-9-13-lox FILNHHDVIIPYLRRINTT-ITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTS  487
st-13-lox-2 FIVDHHDVYLPFLDRINALDGRKAYATRTIFFLSDVGTLKPIAIELSLPQTG--PSSRSK  539
at-lox-3    YMLDYHDIFLPFLDRINALDGRKAYATRTIFFLTRLGTLKPVAIELSLPPHG--PKHRSK  543
hv-lox-1    FMLDYHDLLLPYVHKVRKLDGTTLYGSRALFFLTADGTLRPIAIELTRPKSK--KKPQWR  550
os-13-lox-2 FMLDYHDVLLPFVHAVRELDDTTLYASRTLFFLTEDGTLRPIAIELTRPKSP--NTPQWR  541
st-13-lox   FILDYHDLLLPYVNKVNELKGSMLYGSRTIFFLTPQGTLKPLAIELTRPPVD--DKPQWK  521
at-lox-2    FVLDYHDLLLPYVNKVRELNNTTLYASRTLFFLSDDSTLRPVAIELTCPPNI--NKPQWK  519
os-13-lox   FMLDFHDLFLPYVHKIRSLDHTTMYGSRTVFFLTDDGTLQLLAIELTRPASL--SQPQWR  546
                 **   *             *  *   **     *   ****  *           

pv-13-lox   EVYVPAY--EGVEAYIWLLAKAYVVVNDSCYHQIVSHWLNTHAVVEPFVIATNRQLSVVH  557
gm-lox-3    QVFLPAD--EGVESSIWLLAKAYVVVNDSCYHQLVSHWLNTHAVVEPFIIATNRHLSVVH  541
ah-13-lox   DVILPAK--GRCRKHNLATSQSLCHINDSCYHHLMSHWLNTHAVIEPFVIATNRQLSVIH  544
gm-lox-1    QVVLPAK--EGVESTIWLLAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLH  522
st-9-13-lox KVYTPSD--QGVESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVIEPFVIATNRQLSVLH  545
st-13-lox-2 RVVTPPV--CATGNWTWQIAKAHVCANDAGVHQLVNHWLRTHASLEPFILAAHRQLSAMH  597
at-lox-3    RVLTPPV--DATSNWMWQLAKAHVSSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMH  601
hv-lox-1    QVFTPGCDGSVTGSWLWQLAKAHILAHDAGVHQLVSHWLRTHACTEPYIIAANRQLSQMH  610
os-13-lox-2 QVFTPGS--SVAASWLWQLAKTHVLAHDTGYHQLVSHWLRTHCCVEPYVIAANRRLSQMH  599
st-13-lox   EVYSPND-WNATGAWLWKLAKAHVLSHDSGYHQLVSHWLRTHCCTEPYIIASNRQLSAMH  580
at-lox-2    QVFTPG--YDATSCWLWNLAKTHAISHDAGYHQLISHWL---------------------  556
os-13-lox   QVFTPST--DATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMH  604
             *  *                      *   *    ***                     

pv-13-lox   PVYKLLFPHYRDTMNINSLARKSLVNADGIIEKTFLWSRYSMEMSSVIYKD-WSLVDQAL  616
gm-lox-3    PIYKLLHPHYRDTMNINGLARLSLVNDGGVIEQTFLWGRYSVEMSAVVYKD-WVFTDQAL  600
ah-13-lox   PIYKLLSPHYRDTMNINALARQNLINSDGIIERTFLPSKFSVEMSSAVYKN-WVFTDQAL  603
gm-lox-1    PIYKLLTPHYRNNMNINALARQSLINANGIIETTFLPSKYSVEMSSAVYKN-WVFTDQAL  581
st-9-13-lox PIHKLLYPHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMSAVVYKD-WVFPDQAL  604
st-13-lox-2 PIYKLLDPHMRYTLEINGLARQSLINADGVIEACFTPGRYCMEISAAAYKN-WRFDLEGL  656
at-lox-3    PIFKLLDPHMRYTLEINALARQSLISADGVIEGGFTAGAYGMEMSAAAYKSSWRFDMEGL  661
hv-lox-1    PVYRLLHPHFRFTMEINAQARAMLINAGGIIEGSFVPGEYSLELSSVAYDQQWRFDMEAL  670
os-13-lox-2 PIYRLLHPHFRFTMEINAQARGMLINANGIIESAFAPGKLCMELSSAVYDKFWRFDMEAL  659
st-13-lox   PIYRLLHPHFRYTMEINALAREALINANGVIESSFFPGKYAIELSSIAYGAEWRFDQEAL  640
at-lox-2    -----LHPHFRYTMEINARARQSLVNGGGIIETCFWPGKYALELSSAVYGKLWRFDQEGL  611
os-13-lox   PIYQLLRPHFRYTMRINARA-ARVISAGGIIERSFSPQKYSMELSSVAYDKLWRFDTEAL  663
                 * ** *    **  *        *  *          * *   *   *      *

pv-13-lox   PNDLIKRGVAVADPSAPHGVKLVIEDYPYASDGLEIWDAIKSWVEEYVAFYYKSDEALQK  676
gm-lox-3    PADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLRE  660
ah-13-lox   PADLIKRGMAVEDSSSPYGIRLVIEDYPYAVDGLEIWFAIKEWVQDYVSLYYPTDNDLKK  663
gm-lox-1    PADLIKRGVAIKDPSTPHGVRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKN  641
st-9-13-lox PADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILK  664
st-13-lox-2 PADLIRRGMAVPDSTQPHGLKLLIEDYPYAADGLMIWGAIESWVRDYVNHYYPSSAQVCS  716
at-lox-3    PADLIRRGMAIPDATQPHGLKLLIEDYPYANDGLLLWSAIQTWVRTYVERYYPNPNLIKT  721
hv-lox-1    PEDLIRRGMAVRNPNG--ELELAIEDYPYANDGLLVWDAIKQWALTYVQHYYPCAADIVD  728
os-13-lox-2 PADLIRRGMAIECEDG--KLELTIEDYPYANDGLLIWDSIKEWVSDYVNHYYQLASDIHM  717
st-13-lox   PQNLISRGLAVEDPNEPHGLKLAIEDYPFANDGLVLWDILKQWVTNYVNHYYPQTNLIES  700
at-lox-2    PADLIKRGLAEEDKTAEHGVRLTIPDYPFANDGLILWDAIKEWVTDYVKHYYPDEELITS  671
os-13-lox   PADLVRRGMAEEDPTAEQGLKLAIEDYPFANDGLLIWDAIKTWVQAYVARFYPDADSVAG  723
            *  *  ** *           * * *** * ***  *     *   *    *        

pv-13-lox   DPELQAWWKELVQVGHGDLKDKPWWPKMQSRGDLVAVSTTLIWIASALHAAVNFGQYPLG  736
gm-lox-3    DPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAIIIWTASALHAAVNFGQYPYG  720
ah-13-lox   DPELQNWWKEAVEVGHGDLKDKPWWPKMQTVEELVESCTTIIWTASALHAAVNFGQYPYG  723
gm-lox-1    DSELQHWWKEAVEKGHGDLKDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYG  701
st-9-13-lox DNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQYPYA  724
st-13-lox-2 DRELQAWYAETINVGHVDLRNEEWWPTLATPEDLISILTTLIWLASAQHAALNFGQYPYG  776
at-lox-3    DSELQSWYSESINVGHADLRDADWWPELSTVDDLVSILTTLIWLASAQHAALNFGQYPYG  781
hv-lox-1    DEELQAWWTEVRTKGHADKQDEPWWPELDSHENLAQTLATIMWVTSGHHAAVNFGQYPMA  788
os-13-lox-2 DKELQGWWNEVRTKGHPDKEEG--WPELNCHGSLVEVLTTIIWVASGHHAAVNFGQYPYA  775
st-13-lox   DKELQAWWSEIKNVGHGDKRDEPWWPELKTPNDLIGIITTIVWVTSGHHAAVNFGQYSYA  760
at-lox-2    DEELQGWWSEVRNIGHGDKKDEPWWPVLKTQDDLIGVVTTIAWVTSGHHAAVNFGQYGYG  731
os-13-lox   DEELQAFWTEVRTKGHGDKKDAPWWPKLDSPESLAHTLTNIVWVAAAHHAAVNFGQYDFG  783
            * ***    *    ** *      **       *        *     *** *****   

pv-13-lox   GLILNRPTISRRFMPVEG-----SAEYAALAKNPEKEFLRTITGKKETLIDLTVIEILSR  791
gm-lox-3    GLILNRPTLSRRFMPEKG-----SAEYEELRKNPQKAYLKTITPKFQTLIDLSVIEILSR  775
ah-13-lox   GLILNRPTLSRRLLPEQG-----TAEYEEMVKSHQKAYLRTITPKLETLIDLTTIEILSK  778
gm-lox-1    GLIMNRPTASRRLLPEKG-----TPEYEEMINNHEKAYLRTITSKLPTLISLSVIEILST  756
st-9-13-lox GYLPNRPTVSRRFMPEPG-----TPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSR  779
st-13-lox-2 GYVPNRPPLMRRLIPDEN-----DPEYAVFLADPQKYFFSALPSLLQATKFMAVVDTLST  831
at-lox-3    GYVPNRPPLMRRLIPDES-----DPEYASFISHPEKYYFSSMPSLAQTSKFMAVVDTLST  836
hv-lox-1    GYIPNRPTMARRNMPTE---IGGDDMR-DFVEAPEKVLLDTFPSQYQSAIVLAILDLLST  844
os-13-lox-2 GYFPNRPTIARRNMPTEGQACSHDGMQPTFVEDPVRVLLDTFPSQYQTTLVLPVLNLLSS  835
st-13-lox   GYFPNRPTVARSKMPTED---PTAEEWEWFMNKPEEALLRCFPSQIQATKVMAILDVLSN  817
at-lox-2    GYFPNRPTTTRIRMPTED---PTDEALKEFYESPEKVLLKTYPSQKQATLVMVTLDLLST  788
os-13-lox   GYFPNRPSIARTVMPVEEP--VDGAAMERFLDNPDQALRECFPSQVQATVVMAVLDVLSS  841
            *   ***   *   *                                          ** 

pv-13-lox   HASDEIYLGERDGGDHWTSDAGPLEAFKRFGKKLAEIEEKLVKKNNDETLR-NRTGPAKM  850
gm-lox-3    HASDEVYLGERDN-PNWTSDTRALEAFKRFGNKLAQIENKLSERNNDEKLR-NRCGPVQM  833
ah-13-lox   HASDEVYLGERDN-PHWTFDSRALEAFQRFGNKLSEIEEKLTEKNKDGRLS-NRIGPVEL  836
gm-lox-1    HASDEVYLGQRDN-PHWTSDSKALQAFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQL  815
st-9-13-lox HTTDEIYLGQRES-PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILT-NRSGPVNA  837
st-13-lox-2 HSPDEEYLGERHQPSTWTGDAEIVEAFYKFSAEIGRIEKEIDERNANTKLK-NRCGAGVL  890
at-lox-3    HSPDEEYIGERQQPSIWTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRR-NRCGAGVL  895
hv-lox-1    HSSDEEYMGTHEE-PAWTKDGVINQAFEEFKESTRKIVEQVDEWNNDPDRK-NRHGAGMV  902
os-13-lox-2 HSPGEEYMGTHAE-SAWMADREVRAAFGRFNERMMSIAEMIDCRNKDPERK-NRQGPGVV  893
st-13-lox   HSPDEEYIGEKIE-PYWAEDPVINAAFEVFSGKLKELEGIIDARNNDSKLS-NRNGAGVM  875
at-lox-2    HSPDEEYIGEQQE-ASWANEPVINAAFERFKGKLQYLEGVIDERNVNITLK-NRAGAGVV  846
os-13-lox   HSTDEEYLGGEQT-RPGTATRRLQAAYDGFAARLKEIEGVIDGRNKDRKLK-NRCGAGIL  899
            *   * * *                *   *              *       ** *    

pv-13-lox   PYTLLYPSS----------EEGLTFRGIPNSISI  874
gm-lox-3    PYTLLLPSS----------KEGLTFRGIPNSISI  857
ah-13-lox   PYTLLHPTS----------NEGLTFRGVPNSISI  860
gm-lox-1    PYTLLYPSS----------EEGLTFRGIPNSISI  839
st-9-13-lox PYTLLFPTS----------EGGLTGKGIPNSVSI  861
st-13-lox-2 PYELLAPSS----------GPGVTCRGVPNSVSI  914
at-lox-3    PYELLVPSS----------EPGVTCRGVPNSVSI  919
hv-lox-1    PYVLLRPSDGDPTDGDPTDEKMVMEMGIPNSISI  936
os-13-lox-2 PYVLLKPSYGDPKD-----MTSVMEMGIPNSISI  922
st-13-lox   PYELLKPYS----------EPGVTGKGVPYSISI  899
at-lox-2    KYELLKPTS----------EHGVTGMGVPYSISI  870
os-13-lox   PYQLMKPFS----------DSGVTGMGIPNSTSI  923
             * *  *                   * * * **   


Conserved Residues: 148 (min. 15.8%, max. 17.6%)