Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Mouse Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


m-l12-lox       -GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLF-----RPCRNSEAEFKVDVSE 54
m-e12-lox       MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQL-----RPLLGRKTELEVDVPL 55
m-p12-lox       -GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQL-----RPARGKEEEFDFDVPE 54
m-12r-lox       MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLN-HFGRDFATGAVDDYTVQCQQ 59
m-8-lox         MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLD-HLGKEFSAGAEEDFEVTLPQ 59
m-5-lox         -PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE 59
                     : * **    :*: : : : ::*    :               .   .  .

m-l12-lox       YLGPLLFVRVQKWH--------YLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSIL 106
m-e12-lox       HLGRLLAVKLRKQK--------GLLDSDWFCKSITVQGPGTQG-EAFFPCYSWVQGKETI 106
m-p12-lox       DLGPLQFVKLHKQH--------TVVDDAWFCNLITVQGPGTSA-EAVFPCYRWVQGEGIL 105
m-12r-lox       DLGELIIIRLHKEP------HSFLAKDPWYCNYVQICAP--DCRVYHFPAYQWMDGYETL 111
m-8-lox         DVGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWL--PGAALHFPCYQWLEGAGEL 117
m-5-lox         ELGEIYLVKIEKRK--------YWLHDDWYLKYITLKTP--HGDYIEFPCYRWITGEGEI 109
                 :* :  :::.*              . *: . . :           **.* *: *   :

m-l12-lox       NLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGNWKDGTI----------------- 149
m-e12-lox       CLTEGTALKVTDDTQNLFRKYREQELENRRNVYRWGSWKEGLI----------------- 149
m-p12-lox       SLPEGQARLAGDNALDVFQKYREKELKERQQTYCWATWKEGLP----------------- 148
m-12r-lox       ALREATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPRRCRN 171
m-8-lox         VLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWP-------------RC-- 162
m-5-lox         VLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFP----------------- 152
                 * :. .    ::    : . *.:*:. ::. * *  :  *                   

m-l12-lox       --------------LNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVT 195
m-e12-lox       --------------LPIAGSTERDLPRNQRFMKDKDLDFSLSLVKELKNFAIKGTLDFVS 195
m-p12-lox       --------------QTIAADCKDDLPPNMRFHEEKRLDFEWTLKAGVLEMGLKRVYTLLR 194
m-12r-lox       PNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLRGLVDRKR 231
m-8-lox         ----------------LDHETVKDLDLNIKYSAMKNAKLFFKAHSAYTELKVKGLLDRTG 206
m-5-lox         --------------LSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ 198
                                :       *  : ::   *  .:            :.

m-l12-lox       C-WKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFP 254
m-e12-lox       R-VQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPMLLRRSMRLPARLVLP 254
m-p12-lox       S-WNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLLRRSTSLPSRLVLP 253
m-12r-lox       S-WKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIPDKFPVT 290
m-8-lox         L-WRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLPNNFPVT 265
m-5-lox         SSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVT 258
                   . : :   :*    .  .* *   * ** :*. *:*** ** :::*.  :* .: ..

m-l12-lox       PGMEK----LQAQLDEELKKGTLFEADFFLLDGIKANVIL-CSQQYLAAPLVMLKLQP-D 308
m-e12-lox       PGMED----VQTQLEKELKAGSLFEVDFSLLDGVKPNIII-FKQQYVTAPLVMLKLQP-D 308
m-p12-lox       SGMEE----LQAQLEKELKNGSLFEADFILLDGIPANVIR-GEPQYLAAPLVMLRMDP-G 307
m-12r-lox       DEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELN-GQQQHHCAPMCLLHFGP-D 348
m-8-lox         DEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILN-GKPQFSAAPMTLLHQSSGS 324
m-5-lox         TEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNL-A 317
                  *          *: *:: *.:: .*. :*.*: .        *.  **: :*      

m-l12-lox       GQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVA 368
m-e12-lox       GRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSHLLRGHLMA 368
m-p12-lox       GKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHLLNTHLVA 367
m-12r-lox       GNMMPIAIQLS--QTPGPDCPIFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESHLIG 406
m-8-lox         GPLLPIAIQLK--QTPGPDNPIFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAHLIP 382
m-5-lox         NKIVPIAIQLN--QTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS 375
                . ::*:.**:.  .       :* * *    ***** *** :::  ::   ***. **: 

m-l12-lox       EVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDL 428
m-e12-lox       EVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVSTGSGGHVDI 428
m-p12-lox       EVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTGGGGHVQL 427
m-12r-lox       EAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQV 466
m-8-lox         EVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGFSDL 442
m-5-lox         EVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQM 435
                *.: :*  * **  **::*** .*  :.: **   *  *:    :     . *  *. ::

m-l12-lox       LKQAGAFLTYSSLCPPDDLAERG---LLDIDTCFYAKDALQLWQVMNRYVVGMFDLYYKT 485
m-e12-lox       LQRATSCLTYRSFCPPDDLADRG---LVGVKSSLYAQDALRLWEIISRYVERMVELFYRS 485
m-p12-lox       LTRAVAQLTYHSLCPPDDLANRG---LLRIPSALYARDALQLWEVTARYVKGMVHLFYQS 484
m-12r-lox       MVRGLSELTYKSLCIPNDFVERG---VQDLPGYYFRDDSLAVWYAMERYVTEIITYYYPN 523
m-8-lox         IKRNMEQLNYSVLCLPEDIRARG---VEDIPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS 499
m-5-lox         VQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN 495
                : :    *.*  :* *: :  **      :    :  *.: :*     :.  :.  :* .

m-l12-lox       DQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHL 545
m-e12-lox       DTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQHASTHL 545
m-p12-lox       DDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHAAINQ 544
m-12r-lox       DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS 583
m-8-lox         DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS 559
m-5-lox         DQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF 555
                *  *. * *** : :::    :   :  *:*  : :     .:::: ::*.:.:*::   

m-l12-lox       GQLDWFYWVPNAPCTMRLPPPKTKD-ATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMV 604
m-e12-lox       GQLDWYAWIPNGPCTMRKPPPISKD-VTERDIVDSLPCLQQARMQITVTKFLGRRQPVMV 604
m-p12-lox       GQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQPDMV 604
m-12r-lox       GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR 643
m-8-lox         GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR 619
m-5-lox         GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL 615
                ** :   *:** * :*: **  :*. .  .  : :**    :   :     *        

m-l12-lox       PLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI 662
m-e12-lox       ALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSVTI 662
m-p12-lox       PLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSITI 662
m-12r-lox       PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI 701
m-8-lox         PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI 677
m-5-lox         FLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYYYLSPDRIPNSVAI 673
                 ** . : :*     :  :  *: .*  :   *  **    :** ** *  : **::*

Alignment guide tree:
alignment guide tree