Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Mouse Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

m-l12-lox -GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLF-----RPCRNSEAEFKVDVSE   54
m-e12-lox MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQL-----RPLLGRKTELEVDVPL   55
m-p12-lox -GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQL-----RPARGKEEEFDFDVPE   54
m-12r-lox MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLN-HFGRDFATGAVDDYTVQCQQ   59
m-8-lox   MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLD-HLGKEFSAGAEEDFEVTLPQ   59
m-5-lox   -PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE   59
                 * **     *          *

m-l12-lox YLGPLLFVRVQKWH--------YLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSIL  106
m-e12-lox HLGRLLAVKLRKQK--------GLLDSDWFCKSITVQGPGTQG-EAFFPCYSWVQGKETI  106
m-p12-lox DLGPLQFVKLHKQH--------TVVDDAWFCNLITVQGPGTSA-EAVFPCYRWVQGEGIL  105
m-12r-lox DLGELIIIRLHKEP------HSFLAKDPWYCNYVQICAP--DCRVYHFPAYQWMDGYETL  111
m-8-lox   DVGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWL--PGAALHFPCYQWLEGAGEL  117
m-5-lox   ELGEIYLVKIEKRK--------YWLHDDWYLKYITLKTP--HGDYIEFPCYRWITGEGEI  109
            *        *                *                  ** * *  *

m-l12-lox NLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGNWKDGTI-----------------  149
m-e12-lox CLTEGTALKVTDDTQNLFRKYREQELENRRNVYRWGSWKEGLI-----------------  149
m-p12-lox SLPEGQARLAGDNALDVFQKYREKELKERQQTYCWATWKEGLP-----------------  148
m-12r-lox ALREATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPRRCRN  171
m-8-lox   VLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWP-------------RC--  162
m-5-lox   VLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFP-----------------  152
           *                   *  *       * *     *

m-l12-lox --------------LNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVT  195
m-e12-lox --------------LPIAGSTERDLPRNQRFMKDKDLDFSLSLVKELKNFAIKGTLDFVS  195
m-p12-lox --------------QTIAADCKDDLPPNMRFHEEKRLDFEWTLKAGVLEMGLKRVYTLLR  194
m-12r-lox PNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLRGLVDRKR  231
m-8-lox   ----------------LDHETVKDLDLNIKYSAMKNAKLFFKAHSAYTELKVKGLLDRTG  206
m-5-lox   --------------LSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ  198
                                  *         *

m-l12-lox C-WKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFP  254
m-e12-lox R-VQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPMLLRRSMRLPARLVLP  254
m-p12-lox S-WNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLLRRSTSLPSRLVLP  253
m-12r-lox S-WKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIPDKFPVT  290
m-8-lox   L-WRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLPNNFPVT  265
m-5-lox   SSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVT  258
                      *        * *   * **  *  * *** **    *    *

m-l12-lox PGMEK----LQAQLDEELKKGTLFEADFFLLDGIKANVIL-CSQQYLAAPLVMLKLQP-D  308
m-e12-lox PGMED----VQTQLEKELKAGSLFEVDFSLLDGVKPNIII-FKQQYVTAPLVMLKLQP-D  308
m-p12-lox SGMEE----LQAQLEKELKNGSLFEADFILLDGIPANVIR-GEPQYLAAPLVMLRMDP-G  307
m-12r-lox DEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELN-GQQQHHCAPMCLLHFGP-D  348
m-8-lox   DEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILN-GKPQFSAAPMTLLHQSSGS  324
m-5-lox   TEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNL-A  317
            *          *  *   *     *   * *           *   **   *

m-l12-lox GQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVA  368
m-e12-lox GRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSHLLRGHLMA  368
m-p12-lox GKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHLLNTHLVA  367
m-12r-lox GNMMPIAIQLS--QTPGPDCPIFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESHLIG  406
m-8-lox   GPLLPIAIQLK--QTPGPDNPIFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAHLIP  382
m-5-lox   NKIVPIAIQLN--QTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS  375
              *  **             * * *    ***** ***           ***  **

m-l12-lox EVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDL  428
m-e12-lox EVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVSTGSGGHVDI  428
m-p12-lox EVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTGGGGHVQL  427
m-12r-lox EAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQV  466
m-8-lox   EVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGFSDL  442
m-5-lox   EVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQM  435
          *    *  * **  **  ***  *      **   *  *             *  *

m-l12-lox LKQAGAFLTYSSLCPPDDLAERG---LLDIDTCFYAKDALQLWQVMNRYVVGMFDLYYKT  485
m-e12-lox LQRATSCLTYRSFCPPDDLADRG---LVGVKSSLYAQDALRLWEIISRYVERMVELFYRS  485
m-p12-lox LTRAVAQLTYHSLCPPDDLANRG---LLRIPSALYARDALQLWEVTARYVKGMVHLFYQS  484
m-12r-lox MVRGLSELTYKSLCIPNDFVERG---VQDLPGYYFRDDSLAVWYAMERYVTEIITYYYPN  523
m-8-lox   IKRNMEQLNYSVLCLPEDIRARG---VEDIPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS  499
m-5-lox   VQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN  495
                 * *   * *     **              *    *              *

m-l12-lox DQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHL  545
m-e12-lox DTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQHASTHL  545
m-p12-lox DDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHAAINQ  544
m-12r-lox DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS  583
m-8-lox   DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS  559
m-5-lox   DQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF  555
          *  *  * ***                 * *                  *    *

m-l12-lox GQLDWFYWVPNAPCTMRLPPPKTKD-ATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMV  604
m-e12-lox GQLDWYAWIPNGPCTMRKPPPISKD-VTERDIVDSLPCLQQARMQITVTKFLGRRQPVMV  604
m-p12-lox GQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQPDMV  604
m-12r-lox GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR  643
m-8-lox   GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR  619
m-5-lox   GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL  615
          **     * ** *  *  **   *           **              *

m-l12-lox PLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI  662
m-e12-lox ALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSVTI  662
m-p12-lox PLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSITI  662
m-12r-lox PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI  701
m-8-lox   PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI  677
m-5-lox   FLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYYYLSPDRIPNSVAI  673
           **      *           *   *      *  **     ** ** *    **  *


Conserved Residues: 131 (min. 18.7%, max. 19.8%)


Alignment guide tree:
alignment guide tree