Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Human Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


h-15-lox-2      MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDN-LGKEFTAGAEEDFQVTLPE 59
h-12r-lox       MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNH-FGRDFATGAVGQYTVQCPQ 59
h-5-lox         -PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE 59
h-p12-lox       -GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLR-----PARGEEEEFDHDVAE 54
h-15-lox        -GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW-----PARGKETELKVEVPE 54
                   : : *:**    :*: : : : :**  * :               *   .      :

h-15-lox-2      DVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPP-RGGHLLFPCYQWLEGAGTLVL 118
h-12r-lox       DLGELIIIRLHKER-----YAFFPKDPWYCNYVQICAP-NGRIYHFPAYQWMDGYETLAL 113
h-5-lox         ELGEIQLVRIEKRK-------YWLNDDWYLKYITLKTP-HGDYIEFPCYRWITGDVEVVL 111
h-p12-lox       DLGLLQFVRLRKHH-------WLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSL 107
h-15-lox        YLGPLLFVKLRKRH-------LLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSL 107
                 :* : ::::.*             * *:   . :  *       **.*:*: *   : *

h-15-lox-2      QEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNP---------------------- 156
h-12r-lox       REATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPN 173
h-5-lox         RDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNP---------------------- 149
h-p12-lox       PEGTARLPGDNALDMFQKHREKELKDRQQIYCWATWKE---------------------- 145
h-15-lox        PEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKD---------------------- 145
                 :. .:    :   :: ::*.:*:. ::. * *  :

h-15-lox-2      ---------GWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDR-KGL 206
h-12r-lox       RPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDC-KHS 232
h-5-lox         ---------GFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSS 200
h-p12-lox       ---------GLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTL-LSS 195
h-15-lox        ---------GLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNV-LTC 195
                         *    :       *  : ::   *  .*          : :.

h-15-lox-2      WRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDA 266
h-12r-lox       WKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDD 292
h-5-lox         WNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTE 260
h-p12-lox       WNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSG 255
h-15-lox        WKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPG 255
                *. : :: :**    .  :* . : * :* :*. *:*** ** ::**.  :* .: ..

h-15-lox-2      MVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIN-GKPQFSAAPMTLLYQSPGCGP 325
h-12r-lox       MVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELS-GRKQHHCAPLCLLHFGP-EGK 350
h-5-lox         MVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNL-ANK 319
h-p12-lox       MEE----LQAQLEKELQNGSLFEADFILLDGIPANVIR-GEKQYLAAPLVMLKMEP-NGK 309
h-15-lox        MEE----LQAQLEKELEGGTLFEADFSLLDGIKANVIL-CSQQHLAAPLVMLKLQP-DGK 309
                *          *: *:: *.:: .*. ::.** :        *. .**: :*      .

h-15-lox-2      LLPLAIQLS--QTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEV 383
h-12r-lox       MMPIAIQLS--QTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEA 408
h-5-lox         IVPIAIQLN--QIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEV 377
h-p12-lox       LQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEV 369
h-15-lox        LLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEV 369
                : *:.**:.     .   .:***:*    ***** *** ::*  *:   ***. **:.*.

h-15-lox-2      FTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQ 443
h-12r-lox       FCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMV 468
h-5-lox         FGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQ 437
h-p12-lox       IAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLR 429
h-15-lox        IVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLK 429
                : :*  * **  **::*:::.* *:*: **  .*  *:    :  :  . *  *.  ::

h-15-lox-2      RNMKQLNYSLLCLPEDIRTRGVE---DIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDE 500
h-12r-lox       RALSELTYDSLYLPNDFVERGVQ---DLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDA 525
h-5-lox         RAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQ 497
h-p12-lox       RAAAQLTYCSLCPPDDLADRGLLG---LPGALYAHDALRLWEIIARYVEGIVHLFYQRDD 486
h-15-lox        QAGAFLTYSSFCPPDDLADRGLLG---VKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDV 486
                :    *.*  :  *: :  **:     :    * .*.: :*  :  :.  ::  .*  *

h-15-lox-2      SVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQ 560
h-12r-lox       AVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQ 585
h-5-lox         VVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQ 557
h-p12-lox       IVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQ 546
h-15-lox        AVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQ 546
                 *: * *** : .::    :   :. *:* ...:   : .::*: ::*.:.:**::  **

h-15-lox-2      FDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPL 620
h-12r-lox       MEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPL 645
h-5-lox         YDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFL 617
h-p12-lox       LDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPL 606
h-15-lox        LDWYSWVPNAPCTMRLPPPTTK-DATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAV 605
                 :  :*:** * :*: **  :*  .*   .: :**    :.  :   * *.:       :

h-15-lox-2      GTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI 676
h-12r-lox       GHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI 701
h-5-lox         GMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI 673
h-p12-lox       GHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI 662
h-15-lox        GQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI 661
                * . : :*     :  :  *:  *  :   *  **     ** ** *  : **:: 

Alignment guide tree:
alignment guide tree