Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Human Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

h15-lox-2 MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDN-LGKEFTAGAEEDFQVTLPE   59
h-12r-lox MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNH-FGRDFATGAVGQYTVQCPQ   59
h-5-lox   -PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE   59
h-p12-lox -GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLR-----PARGEEEEFDHDVAE   54
h-15-lox  -GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW-----PARGKETELKVEVPE   54
                 * **     *         **  *                 *           

h15-lox-2 DVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPP-RGGHLLFPCYQWLEGAGTLVL  118
h-12r-lox DLGELIIIRLHKER-----YAFFPKDPWYCNYVQICAP-NGRIYHFPAYQWMDGYETLAL  113
h-5-lox   ELGEIQLVRIEKRK-------YWLNDDWYLKYITLKTP-HGDYIEFPCYRWITGDVEVVL  111
h-p12-lox DLGLLQFVRLRKHH-------WLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSL  107
h-15-lox  YLGPLLFVKLRKRH-------LLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSL  107
            *        *             * *         *       ** * *  *     *

h15-lox-2 QEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNP----------------------  156
h-12r-lox REATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPN  173
h-5-lox   RDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNP----------------------  149
h-p12-lox PEGTARLPGDNALDMFQKHREKELKDRQQIYCWATWKE----------------------  145
h-15-lox  PEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKD----------------------  145
                             *  *       * *                           

h15-lox-2 ---------GWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDR-KGL  206
h-12r-lox RPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDC-KHS  232
h-5-lox   ---------GFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSS  200
h-p12-lox ---------GLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTL-LSS  195
h-15-lox  ---------GLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNV-LTC  195
                   *            *         *   *                       

h15-lox-2 WRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDA  266
h-12r-lox WKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDD  292
h-5-lox   WNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTE  260
h-p12-lox WNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSG  255
h-15-lox  WKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPG  255
          *        **        *     *  *  *  * *** **   **    *        

h15-lox-2 MVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIN-GKPQFSAAPMTLLYQSPGCGP  325
h-12r-lox MVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELS-GRKQHHCAPLCLLHFGP-EGK  350
h-5-lox   MVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNL-ANK  319
h-p12-lox MEE----LQAQLEKELQNGSLFEADFILLDGIPANVIR-GEKQYLAAPLVMLKMEP-NGK  309
h-15-lox  MEE----LQAQLEKELEGGTLFEADFSLLDGIKANVIL-CSQQHLAAPLVMLKLQP-DGK  309
          *          *  *   *     *     **          *   **   *        

h15-lox-2 LLPLAIQLS--QTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEV  383
h-12r-lox MMPIAIQLS--QTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEA  408
h-5-lox   IVPIAIQLN--QIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEV  377
h-p12-lox LQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEV  369
h-15-lox  LLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEV  369
            *  **             *** *    ***** ***   *  *    ***  **  * 

h15-lox-2 FTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQ  443
h-12r-lox FCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMV  468
h-5-lox   FGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQ  437
h-p12-lox IAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLR  429
h-15-lox  IVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLK  429
             *  * **  **  *    * * *  **   *  *             *  *      

h15-lox-2 RNMKQLNYSLLCLPEDIRTRGVE---DIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDE  500
h-12r-lox RALSELTYDSLYLPNDFVERGVQ---DLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDA  525
h-5-lox   RAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQ  497
h-p12-lox RAAAQLTYCSLCPPDDLADRGLLG---LPGALYAHDALRLWEIIARYVEGIVHLFYQRDD  486
h-15-lox  QAGAFLTYSSFCPPDDLADRGLLG---VKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDV  486
               * *     *     **           *  *    *              *  * 

h15-lox-2 SVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQ  560
h-12r-lox AVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQ  585
h-5-lox   VVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQ  557
h-p12-lox IVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQ  546
h-15-lox  AVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQ  546
           *  * ***                 * *             *    *    **    **

h15-lox-2 FDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPL  620
h-12r-lox MEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPL  645
h-5-lox   YDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFL  617
h-p12-lox LDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPL  606
h-15-lox  LDWYSWVPNAPCTMRLPPPTTK-DATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAV  605
               * ** *  *  **   *   *       **            * *          

h15-lox-2 GTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI  676
h-12r-lox GHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI  701
h-5-lox   GMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI  673
h-p12-lox GHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI  662
h-15-lox  GQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI  661
          *      *           *   *      *  **     ** ** *    **  *   


Conserved Residues: 144 (min. 20.5%, max. 21.8%)


Alignment guide tree:
alignment guide tree