Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Human and Mouse Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


h-5-lox         -PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE 59
m-5-lox         -PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE 59
h-15-lox        -GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPAR-----GKETELKVEVPE 54
m-l12-lox       -GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCR-----NSEAEFKVDVSE 54
m-e12-lox       MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQLRPLL-----GRKTELEVDVPL 55
h-p12-lox       -GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPAR-----GEEEEFDHDVAE 54
m-p12-lox       -GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPAR-----GKEEEFDFDVPE 54
h-15-lox-2      MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGK-EFTAGAEEDFQVTLPE 59
m-8-lox         MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGK-EFSAGAEEDFEVTLPQ 59
h-12r-lox       MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGR-DFATGAVGQYTVQCPQ 59
m-12r-lox       MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLNHFGR-DFATGAVDDYTVQCQQ 59
                     : * **    :*: : : : ::*    :               .   .

h-5-lox         ELGEIQLVRIEKRK--------YWLNDDWYLKYITLKTPH--GDYIEFPCYRWITGDVEV 109
m-5-lox         ELGEIYLVKIEKRK--------YWLHDDWYLKYITLKTPH--GDYIEFPCYRWITGEGEI 109
h-15-lox        YLGPLLFVKLRKRH--------LLKDDAWFCNWISVQGPG-AGDEVRFPCYRWVEGNGVL 105
m-l12-lox       YLGPLLFVRVQKWH--------YLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSIL 106
m-e12-lox       HLGRLLAVKLRKQK--------GLLDSDWFCKSITVQGPGTQGEAF-FPCYSWVQGKETI 106
h-p12-lox       DLGLLQFVRLRKHH--------WLVDDAWFCDRITVQGPG-ACAEVAFPCYRWVQGEDIL 105
m-p12-lox       DLGPLQFVKLHKQH--------TVVDDAWFCNLITVQGPG-TSAEAVFPCYRWVQGEGIL 105
h-15-lox-2      DVGRVLLLRVHKAPPVLPL-LGPLAPDAWFCRWFQLTPPR--GGHLLFPCYQWLEGAGTL 116
m-8-lox         DVGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWLP--GAALHFPCYQWLEGAGEL 117
h-12r-lox       DLGELIIIRLHKER------YAFFPKDPWYCNYVQICAPN--GRIYHFPAYQWMDGYETL 111
m-12r-lox       DLGELIIIRLHKEP------HSFLAKDPWYCNYVQICAPD--CRVYHFPAYQWMDGYETL 111
                 :* :  :::.*              . *:   . :           **.* *: *   :

h-5-lox         VLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWME----------------------- 146
m-5-lox         VLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWME----------------------- 146
h-15-lox        SLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGN----------------------- 142
m-l12-lox       NLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGN----------------------- 143
m-e12-lox       CLTEGTALKVTDDTQNLFRKYREQELENRRNVYRWGS----------------------- 143
h-p12-lox       SLPEGTARLPGDNALDMFQKHREKELKDRQQIYCWAT----------------------- 142
m-p12-lox       SLPEGQARLAGDNALDVFQKYREKELKERQQTYCWAT----------------------- 142
h-15-lox-2      VLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKA----------------------- 153
m-8-lox         VLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKT----------------------- 154
h-12r-lox       ALREATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRN 171
m-12r-lox       ALREATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPRRCRN 171
                 * :. .     :    : . *.:*:. ::. * *                         

h-5-lox         --------WNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ 198
m-5-lox         --------WNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ 198
h-15-lox        --------WKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLT 194
m-l12-lox       --------WKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVT 195
m-e12-lox       --------WKEGLILPIAGSTERDLPRNQRFMKDKDLDFSLSLVKELKNFAIKGTLDFVS 195
h-p12-lox       --------WKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS 194
m-p12-lox       --------WKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKAGVLEMGLKRVYTLLR 194
h-15-lox-2      --------YNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKG 205
m-8-lox         --------YIEGWPRCLDHETVKDLDLNIKYSAMKNAKLFFKAHSAYTELKVKGLLDRTG 206
h-12r-lox       PNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKH 231
m-12r-lox       PNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLRGLVDRKR 231
                        :  *    :       *  : ::   *  .:            :.

h-5-lox         SSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVT 258
m-5-lox         SSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVT 258
h-15-lox        -CWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFP 253
m-l12-lox       -CWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFP 254
m-e12-lox       -RVQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPMLLRRSMRLPARLVLP 254
h-p12-lox       -SWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLP 253
m-p12-lox       -SWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLLRRSTSLPSRLVLP 253
h-15-lox-2      -LWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVT 264
m-8-lox         -LWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLPNNFPVT 265
h-12r-lox       -SWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVT 290
m-12r-lox       -SWKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIPDKFPVT 290
                   . : :   :*    .  .* .   * :* :*. *:*** ** :::*.  :* .: ..

h-5-lox         TEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLA- 317
m-5-lox         TEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLA- 317
h-15-lox        PGMEEL----QAQLEKELEGGTLFEADFSLLDGIKANVIL-CSQQHLAAPLVMLKLQPD- 307
m-l12-lox       PGMEKL----QAQLDEELKKGTLFEADFFLLDGIKANVIL-CSQQYLAAPLVMLKLQPD- 308
m-e12-lox       PGMEDV----QTQLEKELKAGSLFEVDFSLLDGVKPNIII-FKQQYVTAPLVMLKLQPD- 308
h-p12-lox       SGMEEL----QAQLEKELQNGSLFEADFILLDGIPANVIR-GEKQYLAAPLVMLKMEPN- 307
m-p12-lox       SGMEEL----QAQLEKELKNGSLFEADFILLDGIPANVIR-GEPQYLAAPLVMLRMDPG- 307
h-15-lox-2      DAMVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIN-GKPQFSAAPMTLLYQSPGC 323
m-8-lox         DEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILN-GKPQFSAAPMTLLHQSSGS 324
h-12r-lox       DDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELS-GRKQHHCAPLCLLHFGPE- 348
m-12r-lox       DEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELN-GQQQHHCAPMCLLHFGPD- 348
                  *          *: *:: *.:: .*. ::.*: .        *.  **: :*      

h-5-lox         NKIVPIAIQLN-QIPGDENP-IFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS 375
m-5-lox         NKIVPIAIQLN-QTPGESNP-IFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS 375
h-15-lox        GKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMA 367
m-l12-lox       GQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVA 368
m-e12-lox       GRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSHLLRGHLMA 368
h-p12-lox       GKLQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVA 367
m-p12-lox       GKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHLLNTHLVA 367
h-15-lox-2      GPLLPLAIQLS-QTPGPNSP-IFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLP 381
m-8-lox         GPLLPIAIQLK-QTPGPDNP-IFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAHLIP 382
h-12r-lox       GKMMPIAIQLS-QTPGPDCP-IFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIA 406
m-12r-lox       GNMMPIAIQLS-QTPGPDCP-IFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESHLIG 406
                . : *:.**:.    .   * :* * *    ***** *** :::  ::   ***. **:

h-5-lox         EVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQM 435
m-5-lox         EVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQM 435
h-15-lox        EVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQL 427
m-l12-lox       EVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDL 428
m-e12-lox       EVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVSTGSGGHVDI 428
h-p12-lox       EVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQL 427
m-p12-lox       EVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTGGGGHVQL 427
h-15-lox-2      EVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSEL 441
m-8-lox         EVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGFSDL 442
h-12r-lox       EAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGV 466
m-12r-lox       EAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQV 466
                *.: :*  * **  **::*:: .*  :.: **   *  *:    .     . *  *.  :

h-5-lox         VQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEG 495
m-5-lox         VQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN 495
h-15-lox        LKQAGAFLTYSSFCPPDDLADRGLLG---VKSSFYAQDALRLWEIIYRYVEGIVSLHYKT 484
m-l12-lox       LKQAGAFLTYSSLCPPDDLAERGLLD---IDTCFYAKDALQLWQVMNRYVVGMFDLYYKT 485
m-e12-lox       LQRATSCLTYRSFCPPDDLADRGLVG---VKSSLYAQDALRLWEIISRYVERMVELFYRS 485
h-p12-lox       LRRAAAQLTYCSLCPPDDLADRGLLG---LPGALYAHDALRLWEIIARYVEGIVHLFYQR 484
m-p12-lox       LTRAVAQLTYHSLCPPDDLANRGLLR---IPSALYARDALQLWEVTARYVKGMVHLFYQS 484
h-15-lox-2      IQRNMKQLNYSLLCLPEDIRTRGVED---IPGYYYRDDGMQIWGAVERFVSEIIGIYYPS 498
m-8-lox         IKRNMEQLNYSVLCLPEDIRARGVED---IPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS 499
h-12r-lox       MVRALSELTYDSLYLPNDFVERGVQD---LPGYYYRDDSLAVWNALEKYVTEIITYYYPS 523
m-12r-lox       MVRGLSELTYKSLCIPNDFVERGVQD---LPGYYFRDDSLAVWYAMERYVTEIITYYYPN 523
                : :    *.*  :  *: :  **:     :    :  *.: :*     :.  :.  .*  

h-5-lox         DQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNF 555
m-5-lox         DQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF 555
h-15-lox        DVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHL 544
m-l12-lox       DQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHL 545
m-e12-lox       DTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQHASTHL 545
h-p12-lox       DDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQ 544
m-p12-lox       DDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHAAINQ 544
h-15-lox-2      DESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSA 558
m-8-lox         DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS 559
h-12r-lox       DAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNT 583
m-12r-lox       DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS 583
                *  *. * *** : .::    :   :  *:*  . :     .:::: ::*.:.:*::

h-5-lox         GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL 615
m-5-lox         GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL 615
h-15-lox        GQLDWYSWVPNAPCTMRLPPPTTK-DATLETVMATLPNFHQASLQMSITWQLGRRQPVMV 603
m-l12-lox       GQLDWFYWVPNAPCTMRLPPPKTK-DATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMV 604
m-e12-lox       GQLDWYAWIPNGPCTMRKPPPISK-DVTERDIVDSLPCLQQARMQITVTKFLGRRQPVMV 604
h-p12-lox       GQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMV 604
m-p12-lox       GQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQPDMV 604
h-15-lox-2      GQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQR 618
m-8-lox         GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR 619
h-12r-lox       GQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRR 643
m-12r-lox       GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR 643
                ** :   *:** * :*: **  :*  .     : :**    :   :     *        

h-5-lox         FLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI 673
m-5-lox         FLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYYYLSPDRIPNSVAI 673
h-15-lox        AVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI 661
m-l12-lox       PLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI 662
m-e12-lox       ALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSVTI 662
h-p12-lox       PLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI 662
m-p12-lox       PLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSITI 662
h-15-lox-2      PLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI 676
m-8-lox         PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI 677
h-12r-lox       PLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI 701
m-12r-lox       PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI 701
                 :* . : :*     :  :  *:  *  :   *  **     ** ** *  : **::*

Alignment guide tree:
alignment guide tree