Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Human and Mouse Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

h-5-lox    -PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE   59
m-5-lox    -PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE   59
h-15-lox   -GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPAR-----GKETELKVEVPE   54
m-l12-lox  -GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCR-----NSEAEFKVDVSE   54
m-e12-lox  MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQLRPLL-----GRKTELEVDVPL   55
h-p12-lox  -GRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPAR-----GEEEEFDHDVAE   54
m-p12-lox  -GAYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPAR-----GKEEEFDFDVPE   54
h-15-lox-2 MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGK-EFTAGAEEDFQVTLPE   59
m-8-lox    MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGK-EFSAGAEEDFEVTLPQ   59
h-12r-lox  MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGR-DFATGAVGQYTVQCPQ   59
m-12r-lox  MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLNHFGR-DFATGAVDDYTVQCQQ   59
                  * **     *          *                                

h-5-lox    ELGEIQLVRIEKRK--------YWLNDDWYLKYITLKTPH--GDYIEFPCYRWITGDVEV  109
m-5-lox    ELGEIYLVKIEKRK--------YWLHDDWYLKYITLKTPH--GDYIEFPCYRWITGEGEI  109
h-15-lox   YLGPLLFVKLRKRH--------LLKDDAWFCNWISVQGPG-AGDEVRFPCYRWVEGNGVL  105
ml12-lox   YLGPLLFVRVQKWH--------YLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSIL  106
me-12-lox  HLGRLLAVKLRKQK--------GLLDSDWFCKSITVQGPGTQGEAF-FPCYSWVQGKETI  106
hp-12-lox  DLGLLQFVRLRKHH--------WLVDDAWFCDRITVQGPG-ACAEVAFPCYRWVQGEDIL  105
mp-12-lox  DLGPLQFVKLHKQH--------TVVDDAWFCNLITVQGPG-TSAEAVFPCYRWVQGEGIL  105
h-15-lox-2 DVGRVLLLRVHKAPPVLPL-LGPLAPDAWFCRWFQLTPPR--GGHLLFPCYQWLEGAGTL  116
m-8-lox    DVGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWLP--GAALHFPCYQWLEGAGEL  117
h-12r-lox  DLGELIIIRLHKER------YAFFPKDPWYCNYVQICAPN--GRIYHFPAYQWMDGYETL  111
m-12r-lox  DLGELIIIRLHKEP------HSFLAKDPWYCNYVQICAPD--CRVYHFPAYQWMDGYETL  111
             *        *                *                  ** * *  *

h-5-lox    VLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWME-----------------------  146
m-5-lox    VLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWME-----------------------  146
h-15-lox   SLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGN-----------------------  142
ml12-lox   NLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGN-----------------------  143
me-12-lox  CLTEGTALKVTDDTQNLFRKYREQELENRRNVYRWGS-----------------------  143
hp-12-lox  SLPEGTARLPGDNALDMFQKHREKELKDRQQIYCWAT-----------------------  142
mp-12-lox  SLPEGQARLAGDNALDVFQKYREKELKERQQTYCWAT-----------------------  142
h-15-lox-2 VLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKA-----------------------  153
m-8-lox    VLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKT-----------------------  154
h-12r-lox  ALREATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRN  171
m-12r-lox  ALREATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPRRCRN  171
            *                   *  *       * *

h-5-lox    --------WNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ  198
m-5-lox    --------WNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQ  198
h-15-lox   --------WKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLT  194
ml12-lox   --------WKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVT  195
me-12-lox  --------WKEGLILPIAGSTERDLPRNQRFMKDKDLDFSLSLVKELKNFAIKGTLDFVS  195
hp-12-lox  --------WKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS  194
mp-12-lox  --------WKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKAGVLEMGLKRVYTLLR  194
h-15-lox-2 --------YNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKG  205
m-8-lox    --------YIEGWPRCLDHETVKDLDLNIKYSAMKNAKLFFKAHSAYTELKVKGLLDRTG  206
h-12r-lox  PNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKH  231
m-12r-lox  PNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLRGLVDRKR  231
                     *            *         *

h-5-lox    SSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVT  258
m-5-lox    SSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVT  258
h-15-lox   -CWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFP  253
ml12-lox   -CWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFP  254
me-12-lox  -RVQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPMLLRRSMRLPARLVLP  254
hp-12-lox  -SWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLP  253
mp-12-lox  -SWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPMLLRRSTSLPSRLVLP  253
h-15-lox-2 -LWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVT  264
m-8-lox    -LWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLPNNFPVT  265
h-12r-lox  -SWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVT  290
m-12r-lox  -SWKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIPDKFPVT  290
                       *        *     *  *  *  * *** **    *    *

h-5-lox    TEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLA-  317
m-5-lox    TEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLA-  317
h-15-lox   PGMEEL----QAQLEKELEGGTLFEADFSLLDGIKANVIL-CSQQHLAAPLVMLKLQPD-  307
ml12-lox   PGMEKL----QAQLDEELKKGTLFEADFFLLDGIKANVIL-CSQQYLAAPLVMLKLQPD-  308
me-12-lox  PGMEDV----QTQLEKELKAGSLFEVDFSLLDGVKPNIII-FKQQYVTAPLVMLKLQPD-  308
hp-12-lox  SGMEEL----QAQLEKELQNGSLFEADFILLDGIPANVIR-GEKQYLAAPLVMLKMEPN-  307
mp-12-lox  SGMEEL----QAQLEKELKNGSLFEADFILLDGIPANVIR-GEPQYLAAPLVMLRMDPG-  307
h-15-lox-2 DAMVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIN-GKPQFSAAPMTLLYQSPGC  323
m-8-lox    DEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILN-GKPQFSAAPMTLLHQSSGS  324
h-12r-lox  DDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELS-GRKQHHCAPLCLLHFGPE-  348
m-12r-lox  DEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELN-GQQQHHCAPMCLLHFGPD-  348
             *          *  *   *     *     *           *   **   *

h-5-lox    NKIVPIAIQLN-QIPGDENP-IFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS  375
m-5-lox    NKIVPIAIQLN-QTPGESNP-IFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVS  375
h-15-lox   GKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMA  367
ml12-lox   GQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVA  368
me-12-lox  GRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSHLLRGHLMA  368
hp-12-lox  GKLQPMVIQIQPPSPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVA  367
mp-12-lox  GKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFHLLNTHLVA  367
h-15-lox-2 GPLLPLAIQLS-QTPGPNSP-IFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLP  381
m-8-lox    GPLLPIAIQLK-QTPGPDNP-IFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAHLIP  382
h-12r-lox  GKMMPIAIQLS-QTPGPDCP-IFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIA  406
m-12r-lox  GNMMPIAIQLS-QTPGPDCP-IFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESHLIG  406
               *  **          *  * * *    ***** ***           ***  **

h-5-lox    EVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQM  435
m-5-lox    EVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQM  435
h-15-lox   EVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQL  427
ml12-lox   EVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDL  428
me-12-lox  EVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVSTGSGGHVDI  428
hp-12-lox  EVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQL  427
mp-12-lox  EVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRTRTQLISDGGIFDQVVSTGGGGHVQL  427
h-15-lox-2 EVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSEL  441
m-8-lox    EVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGFSDL  442
h-12r-lox  EAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGV  466
m-12r-lox  EAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQV  466
           *    *  * **  **  *    *      **   *  *             *  *

h-5-lox    VQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEG  495
m-5-lox    VQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN  495
h-15-lox   LKQAGAFLTYSSFCPPDDLADRGLLG---VKSSFYAQDALRLWEIIYRYVEGIVSLHYKT  484
ml12-lox   LKQAGAFLTYSSLCPPDDLAERGLLD---IDTCFYAKDALQLWQVMNRYVVGMFDLYYKT  485
me-12-lox  LQRATSCLTYRSFCPPDDLADRGLVG---VKSSLYAQDALRLWEIISRYVERMVELFYRS  485
hp-12-lox  LRRAAAQLTYCSLCPPDDLADRGLLG---LPGALYAHDALRLWEIIARYVEGIVHLFYQR  484
mp-12-lox  LTRAVAQLTYHSLCPPDDLANRGLLR---IPSALYARDALQLWEVTARYVKGMVHLFYQS  484
h-15-lox-2 IQRNMKQLNYSLLCLPEDIRTRGVED---IPGYYYRDDGMQIWGAVERFVSEIIGIYYPS  498
m-8-lox    IKRNMEQLNYSVLCLPEDIRARGVED---IPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS  499
h-12r-lox  MVRALSELTYDSLYLPNDFVERGVQD---LPGYYYRDDSLAVWNALEKYVTEIITYYYPS  523
m-12r-lox  MVRGLSELTYKSLCIPNDFVERGVQD---LPGYYFRDDSLAVWYAMERYVTEIITYYYPN  523
                  * *     *     **              *    *              *

h-5-lox    DQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNF  555
m-5-lox    DQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF  555
h-15-lox   DVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHL  544
ml12-lox   DQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHL  545
me-12-lox  DTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQHASTHL  545
hp-12-lox  DDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQ  544
mp-12-lox  DDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHAAINQ  544
h-15-lox-2 DESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSA  558
m-8-lox    DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS  559
h-12r-lox  DAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNT  583
m-12r-lox  DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS  583
           *  *  * ***                 * *                  *    *

h-5-lox    GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL  615
m-5-lox    GQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENEL  615
h-15-lox   GQLDWYSWVPNAPCTMRLPPPTTK-DATLETVMATLPNFHQASLQMSITWQLGRRQPVMV  603
ml12-lox   GQLDWFYWVPNAPCTMRLPPPKTK-DATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMV  604
me-12-lox  GQLDWYAWIPNGPCTMRKPPPISK-DVTERDIVDSLPCLQQARMQITVTKFLGRRQPVMV  604
hp-12-lox  GQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMV  604
mp-12-lox  GQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQPDMV  604
h-15-lox-2 GQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQR  618
m-8-lox    GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR  619
h-12r-lox  GQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRR  643
m-12r-lox  GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR  643
           **     * ** *  *  **   *           **              *

h-5-lox    FLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI  673
m-5-lox    FLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYYYLSPDRIPNSVAI  673
h-15-lox   AVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI  661
ml12-lox   PLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI  662
me-12-lox  ALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSVTI  662
hp-12-lox  PLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI  662
mp-12-lox  PLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENSITI  662
h-15-lox-2 PLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI  676
m-8-lox    PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI  677
h-12r-lox  PLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI  701
m-12r-lox  PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI  701
             *      *           *   *      *  **     ** ** *    **  *


Conserved Residues: 125 (min. 17.8%, max. 18.9%)


Alignment guide tree:
alignment guide tree