Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 5-Lox Activating Proteins


CLUSTAL W (1.81) multiple sequence alignment


flap-human       MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC 60
flap-rhesus      MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC 60
flap-pig         MDQEAMGNIVLLAIVTLISVVQNAFFAHKVEHESKTHNGRSFQRTGTPAFERVYTANQNC 60
flap-sheep       MDQETVGNIVLLAIVTLISVVQNGFFAHKVEHESKTHNGRSFQRTGPLAFERVYTANQNC 60
flap-horse       MDQETVGNVVLLAIVTLISVIQNGFFAHKVEHESKTQNGRSFQRTGTLAFERVYTANQNC 60
flap-rabbit      MDQEAVGNVVLLAIVTLISVVQNGFFAHKVEHESRNQNGRSFQRTGTLAFERVYTANQNC 60
flap-mouse       MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNC 60
flap-rat         MDQEAVGNVVLLAIVTLISVVQNAFFAHKVEIESKAQSGRSFQRTGTLAFERVYTANQNC 60
                 ****::**:****:******:**.******* **: :.********. ************

flap-human       VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-rhesus      VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-pig         VDAYPTFLVVLWSAGLFCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-sheep       VDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-horse       VDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERRQSTPGYIFGKRIIL 120
flap-rabbit      VDAYPTFLAVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-mouse       VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
flap-rat         VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL 120
                 ********.:**:***:**************:************* **************

flap-human       FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP 161
flap-rhesus      FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTT-------- 153
flap-pig         FLFLMSLAGIFNYFLILFFGSDFENYIKTITTT-------- 153
flap-sheep       FLFAMSLAGILNYFLIAFFGSDFENYIKTVTTT-------- 153
flap-horse       FLFLMSLAGIFNYYLILFFGSDFENYIKTITTT-------- 153
flap-rabbit      FLFLMSLAGILNYCLILLFGSDFENYIKTISTT-------- 153
flap-mouse       FLFLMSFAGILNHYLIFFFGSYFENYIRTVSTT-------- 153
flap-rat         FLFLMSIAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP 161
                 *** **.***:*: ** :*** *****:*::**        

Alignment guide tree:
alignment guide tree