Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 5-Lox Activating Proteins


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

flap-human  MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC   60
flap-rhesus MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC   60
flap-pig    MDQEAMGNIVLLAIVTLISVVQNAFFAHKVEHESKTHNGRSFQRTGTPAFERVYTANQNC   60
flap-sheep  MDQETVGNIVLLAIVTLISVVQNGFFAHKVEHESKTHNGRSFQRTGPLAFERVYTANQNC   60
flap-horse  MDQETVGNVVLLAIVTLISVIQNGFFAHKVEHESKTQNGRSFQRTGTLAFERVYTANQNC   60
flap-rabbit MDQEAVGNVVLLAIVTLISVVQNGFFAHKVEHESRNQNGRSFQRTGTLAFERVYTANQNC   60
flap-mouse  MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNC   60
flap-rat    MDQEAVGNVVLLAIVTLISVVQNAFFAHKVEIESKAQSGRSFQRTGTLAFERVYTANQNC   60
            ****  ** **** ****** ** ******* **    ********  ************

flap-human  VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-rhesus VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-pig    VDAYPTFLVVLWSAGLFCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-sheep  VDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-horse  VDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERRQSTPGYIFGKRIIL  120
flap-rabbit VDAYPTFLAVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-mouse  VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
flap-rat    VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL  120
            ********  ** *** ************** ************* **************

flap-human  FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP  161
flap-rhesus FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTT--------  153
flap-pig    FLFLMSLAGIFNYFLILFFGSDFENYIKTITTT--------  153
flap-sheep  FLFAMSLAGILNYFLIAFFGSDFENYIKTVTTT--------  153
flap-horse  FLFLMSLAGIFNYYLILFFGSDFENYIKTITTT--------  153
flap-rabbit FLFLMSLAGILNYCLILLFGSDFENYIKTISTT--------  153
flap-mouse  FLFLMSFAGILNHYLIFFFGSYFENYIRTVSTT--------  153
flap-rat    FLFLMSIAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP  161
            *** ** *** *  **  *** ***** *  **          


Conserved Residues: 123 (min. 76.4%, max. 80.4%)


Alignment guide tree:
alignment guide tree