Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Epidermis-Type Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


m-8-lox         MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQD 60
h-15-lox-2      MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED 60
bt-15-lox-2     ---------TGEAFGVGTWDKISVSIVGTRGETPLLPLDRLGKEFNAGPEEDFEVTPPED 51
m-12r-lox       MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLNHFGRDFATGAVDDYTVQCQQD 60
h-12r-lox       MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD 60
m-e-lox-3       MAVYRLCVTTGSYLKAGTLDNIYATLVGTCGESPKQKLDRVGRDFASGSVQKYKVRCEAE 60
h-e-lox-3       MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAE 60
                         **     ** *.:  ::*** **:    *:..*::* .*.  .: *    :

m-8-lox         VGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWLPGAALHFPCYQWLEGAGELVLR 120
h-15-lox-2      VGRVLLLRVHKAPPVLPLLG-PLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQ 119
bt-15-lox-2     VGRVLLVRVHKAPPAISAPR-ALGRDAWFCRWLHVTPPRGGALCFPCYQWLEGERSLVLR 110
m-12r-lox       LGELIIIRLHKEPHSF------LAKDPWYCNYVQICAPDCRVYHFPAYQWMDGYETLALR 114
h-12r-lox       LGELIIIRLHKERYAF------FPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALR 114
m-e-lox-3       LGEILLLRLHKERFAF------FCKDPWYCSRICVTAPDGSAVHFPCYQWIDGYCTVELR 114
h-e-lox-3       LGELLLLRVHKERYAF------FRKDSWYCSRICVTEPDGSVSHFPCYQWIEGYCTVELR 114
                :* ::::*:**    .      :  *.*:*  . :         **.***::*   : *:

m-8-lox         EGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWPRCLDHETVKDLD-------- 172
h-15-lox-2      EGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLE-------- 171
bt-15-lox-2     EGTAKISWEDHHPTLQQQRREELQARRETYRWKTYIPGWPRCLDEETVKDLN-------- 162
m-12r-lox       EATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPR------- 167
h-12r-lox       EATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVR------- 167
m-e-lox-3       PGTARTICQDSLPLLLDHRKRELRARQECYRWKIFAPGFPRMVDVSSFQEMESDKKFALT 174
h-e-lox-3       PGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALT 174
                 .:.:    *  * * ::* .*:.:::. * *: :  * *  :.  : .           

m-8-lox         ---------------------------------LNIKYSAMKNAKLFFKAHSAYTELKVK 199
h-15-lox-2      ---------------------------------LNIKYSTAKNANFYLQAGSAFAEMKIK 198
bt-15-lox-2     ---------------------------------LNIKYSVAKNTTFYLRGGSALAELKLK 189
m-12r-lox       ---RCRNPNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLR 224
h-12r-lox       ---RHRNPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVR 224
m-e-lox-3       KTVPCAEQDDNSGNRYLPGFPMKIDIPSLLHMEPNIRYSATKTASLIFNALPASFGMKIR 234
h-e-lox-3       KTTTCVDQGDSSGNRYLPGLPMKIDIPSLMYMEPNVRYSATKTISLLFNAIPASLGMKLR 234
                                                  *:::*  *. .:  .  .    :*::

m-8-lox         GLLDRTGLWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLP 259
h-15-lox-2      GLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLP 258
bt-15-lox-2     GLLDRKGLWKSLKEMRRVFNFRKTPAVEYVCEHWQEDAFFAYQFLNGLNPVLIRRCHHLP 249
m-12r-lox       GLVDRKRSWKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIP 284
h-12r-lox       GLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIP 284
m-e-lox-3       GLLDRKGSWKRLDDIRNIFWCHKTFTSEYVTEHWCEDSFFGYQYLNGVNPVMLHCLSSLP 294
h-e-lox-3       GLLDRKGSWKKLDDMQNIFWCHKTFTTKYVTEHWCEDHFFGYQYLNGVNPVMLHCISSLP 294
                **:* .  *: * :::.:*   :: . ::.  ** ** **. *:***:** :::    :*

m-8-lox         NNFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILNGKPQFSAAPMTLLH 319
h-15-lox-2      KNFPVTDAMVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLY 318
bt-15-lox-2     KNFPVTDAMVAPVLGPGTSLQAELEKGSLFLVDYDLLAGVRTNVINGRPQFSTAPMTLLY 309
m-12r-lox       DKFPVTDEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELNGQQQHHCAPMCLLH 344
h-12r-lox       DKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLH 344
m-e-lox-3       SKLPVTNDMVAPLLGPGTCLQTELERGHIFLADYWILAEAPVHCINSLQQYVTAPLCLLW 354
h-e-lox-3       SKLPVTNDMVAPLLGQDTCLQTELERGNIFLADYWILAEAPTHCLNGRQQYVAAPLCLLW 354
                .::***: ***..** .*.**:***:* ::*.*: ::    .  :..  *.  **: ** 

m-8-lox         QSSGSGPLLPIAIQLKQTPGPDNPIFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAH 379
h-15-lox-2      QSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSH 378
bt-15-lox-2     QRPGRGPLVPLAIQLSQTPGPNSPIFLPSDDKWDWLLAKTWVRNAEFSIHEALTHLLQAH 369
m-12r-lox       FGP-DGNMMPIAIQLSQTPGPDCPIFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESH 403
h-12r-lox       FGP-EGKMMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETH 403
m-e-lox-3       LNP-QGVLLPLAIQLSQTPGPESPIFLPTDCELDWLLAKTWVRNSEFLVHENNTHFLCTH 413
h-e-lox-3       LSP-QGALVPLAIQLSQTPGPDSPIFLPTDSEWDWLLAKTWVRNSEFLVHENNTHFLCTH 413
                  .  * ::*:****.*****: *****.*   ********** :**  **  :*:* :*

m-8-lox         LIPEVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGF 439
h-15-lox-2      LLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGF 438
bt-15-lox-2     LVPEVFALATLRQLPHCHPLFKLLIPHTRYTLHINTLARERLIAPGQVVDRSTGLGIGSF 429
m-12r-lox       LIGEAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGF 463
h-12r-lox       LIAEAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGF 463
m-e-lox-3       LLCEAFSMATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPDGLVDKVTSIGRQGL 473
h-e-lox-3       LLCEAFAMATLRQLPLCHPIYKLLLPHTRYTLQVNTIARATLLNPEGLVDQVTSIGRQGL 473
                *: *.* :* **:** ***::***:** **.:::*::.*  *:    :  :  .:*  .:

m-8-lox         SDLIKRNMEQLNYSVLCLPEDIRARGVEDIPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS 499
h-15-lox-2      SELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPS 498
bt-15-lox-2     SELIQKNMKQLNYSALCLPDDIRARGVEDIPDYYYRDDGMQVWGAVERFVSEMIGIYYPS 489
m-12r-lox       AQVMVRGLSELTYKSLCIPNDFVERGVQDLPGYYFRDDSLAVWYAMERYVTEIITYYYPN 523
h-12r-lox       AGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPS 523
m-e-lox-3       IYLMSTGLAHFTYTDFCLPDSIRARGVLTIPNYHYRDDGLKIWAAIERFVSEIVSYYYPS 533
h-e-lox-3       IYLMSTGLAHFTYTNFCLPDSLRARGVLAIPNYHYRDDGLKIWAAIESFVSEIVGYYYPS 533
                  ::   : .:.*  : :*:.:  ***  :*.*::***.: :* *:: :*:*::  ***.

m-8-lox         DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS 559
h-15-lox-2      DESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSA 558
bt-15-lox-2     DESVRDDSELQAWVREIFSEGFLGRESSGLPSTLGTREALIQFVTMVIFNCSAKHSAVSA 549
m-12r-lox       DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS 583
h-12r-lox       DAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNT 583
m-e-lox-3       DASVQQDCELQAWVGEIFAQAFLGRESSGFPSRLCTPGELVKYLTAIIFNCSAQHAAFNS 593
h-e-lox-3       DASVQQDSELQAWTGEIFAQAFLGRESSGFPSRLCTPGEMVKFLTAIIFNCSAQHAAVNS 593
                * :*. * ***.*. *** : :*.:****:*  * *   ::.::* :::.***:*:*..:

m-8-lox         GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR 619
h-15-lox-2      GQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQR 618
bt-15-lox-2     GQFDFAAWMPNLPPSMQLPPPTSKGQARLEGFLATLPPVNATCDVVIALWLLSKEPGDRR 609
m-12r-lox       GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR 643
h-12r-lox       GQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRR 643
m-e-lox-3       GQHDFGAWMPNAPSSMRQPPPQTKGDTTMKSYLDTLPEVNTTCRNLLLFWLVSQEPKDQR 653
h-e-lox-3       GQHDFGAWMPNAPSSMRQPPPQTKGTTTLKTYLDTLPEVNISCNNLLLFWLVSQEPKDQR 653
                ** :   **** *.:*: **  :** :  : :: *** *: :.  :: :* :. ** *:*

m-8-lox         PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI 677
h-15-lox-2      PLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI 676
bt-15-lox-2     PLGTYPDEYFTEEAPRRSIAAFQSRLAEISRDIQERNHSLALPYPYLDPPLIENSVSI 667
m-12r-lox       PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI 701
h-12r-lox       PLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI 701
m-e-lox-3       PLGTYPDEHFTEEAPRQSIAAFQNCLAQISKDIRERNQSLALPYAYLDPPLIENSVSI 711
h-e-lox-3       PLGTYPDEHFTEEAPRRSIAAFQSRLAQISRDIQERNQGLALPYTYLDPPLIENSVSI 711
                *** :** :*.*:.**:*: :*:  * :**:.*::**: * :** **** *****:**