Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of Epidermis-Type Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

m-8-lox     MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQD   60
h-15-lox-2  MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED   60
bt-15-lox-2 ---------TGEAFGVGTWDKISVSIVGTRGETPLLPLDRLGKEFNAGPEEDFEVTPPED   51
m-12r-lox   MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLNHFGRDFATGAVDDYTVQCQQD   60
h-12r-lox   MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD   60
m-e-lox-3   MAVYRLCVTTGSYLKAGTLDNIYATLVGTCGESPKQKLDRVGRDFASGSVQKYKVRCEAE   60
h-e-lox-3   MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAE   60
                     **     ** *      *** **     *   *  *  *      *

m-8-lox     VGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWLPGAALHFPCYQWLEGAGELVLR  120
h-15-lox-2  VGRVLLLRVHKAPPVLPLLG-PLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQ  119
bt-15-lox-2 VGRVLLVRVHKAPPAISAPR-ALGRDAWFCRWLHVTPPRGGALCFPCYQWLEGERSLVLR  110
m-12r-lox   LGELIIIRLHKEPHSF------LAKDPWYCNYVQICAPDCRVYHFPAYQWMDGYETLALR  114
h-12r-lox   LGELIIIRLHKERYAF------FPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALR  114
m-e-lox-3   LGEILLLRLHKERFAF------FCKDPWYCSRICVTAPDGSAVHFPCYQWIDGYCTVELR  114
h-e-lox-3   LGELLLLRVHKERYAF------FRKDSWYCSRICVTEPDGSVSHFPCYQWIEGYCTVELR  114
             *     * **              * * *              ** ***  *     *

m-8-lox     EGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWPRCLDHETVKDLD--------  172
h-15-lox-2  EGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLE--------  171
bt-15-lox-2 EGTAKISWEDHHPTLQQQRREELQARRETYRWKTYIPGWPRCLDEETVKDLN--------  162
m-12r-lox   EATGKITADDTLPILLEHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPR-------  167
h-12r-lox   EATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVR-------  167
m-e-lox-3   PGTARTICQDSLPLLLDHRKRELRARQECYRWKIFAPGFPRMVDVSSFQEMESDKKFALT  174
h-e-lox-3   PGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALT  174
                     *  * *   *  *       * *     * *

m-8-lox     ---------------------------------LNIKYSAMKNAKLFFKAHSAYTELKVK  199
h-15-lox-2  ---------------------------------LNIKYSTAKNANFYLQAGSAFAEMKIK  198
bt-15-lox-2 ---------------------------------LNIKYSVAKNTTFYLRGGSALAELKLK  189
m-12r-lox   ---RCRNPNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLR  224
h-12r-lox   ---RHRNPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVR  224
m-e-lox-3   KTVPCAEQDDNSGNRYLPGFPMKIDIPSLLHMEPNIRYSATKTASLIFNALPASFGMKIR  234
h-e-lox-3   KTTTCVDQGDSSGNRYLPGLPMKIDIPSLMYMEPNVRYSATKTISLLFNAIPASLGMKLR  234
                                              *   *  *               *

m-8-lox     GLLDRTGLWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLP  259
h-15-lox-2  GLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLP  258
bt-15-lox-2 GLLDRKGLWKSLKEMRRVFNFRKTPAVEYVCEHWQEDAFFAYQFLNGLNPVLIRRCHHLP  249
m-12r-lox   GLVDRKRSWKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIP  284
h-12r-lox   GLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIP  284
m-e-lox-3   GLLDRKGSWKRLDDIRNIFWCHKTFTSEYVTEHWCEDSFFGYQYLNGVNPVMLHCLSSLP  294
h-e-lox-3   GLLDRKGSWKKLDDMQNIFWCHKTFTTKYVTEHWCEDHFFGYQYLNGVNPVMLHCISSLP  294
            ** *    *  *      *             ** ** **  * *** **         *

m-8-lox     NNFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILNGKPQFSAAPMTLLH  319
h-15-lox-2  KNFPVTDAMVASLLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLY  318
bt-15-lox-2 KNFPVTDAMVAPVLGPGTSLQAELEKGSLFLVDYDLLAGVRTNVINGRPQFSTAPMTLLY  309
m-12r-lox   DKFPVTDEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELNGQQQHHCAPMCLLH  344
h-12r-lox   DKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLH  344
m-e-lox-3   SKLPVTNDMVAPLLGPGTCLQTELERGHIFLADYWILAEAPVHCINSLQQYVTAPLCLLW  354
h-e-lox-3   SKLPVTNDMVAPLLGQDTCLQTELERGNIFLADYWILAEAPTHCLNGRQQYVAAPLCLLW  354
               ***  ***  **  * ** *** *   * *                *   **  **

m-8-lox     QSSGSGPLLPIAIQLKQTPGPDNPIFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAH  379
h-15-lox-2  QSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSH  378
bt-15-lox-2 QRPGRGPLVPLAIQLSQTPGPNSPIFLPSDDKWDWLLAKTWVRNAEFSIHEALTHLLQAH  369
m-12r-lox   FGP-DGNMMPIAIQLSQTPGPDCPIFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESH  403
h-12r-lox   FGP-EGKMMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETH  403
m-e-lox-3   LNP-QGVLLPLAIQLSQTPGPESPIFLPTDCELDWLLAKTWVRNSEFLVHENNTHFLCTH  413
h-e-lox-3   LSP-QGALVPLAIQLSQTPGPDSPIFLPTDSEWDWLLAKTWVRNSEFLVHENNTHFLCTH  413
                 *   * **** *****  ***** *   **********  **  **   * *  *

m-8-lox     LIPEVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGF  439
h-15-lox-2  LLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGF  438
bt-15-lox-2 LVPEVFALATLRQLPHCHPLFKLLIPHTRYTLHINTLARERLIAPGQVVDRSTGLGIGSF  429
m-12r-lox   LIGEAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGF  463
h-12r-lox   LIAEAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGF  463
m-e-lox-3   LLCEAFSMATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPDGLVDKVTSIGRQGL  473
h-e-lox-3   LLCEAFAMATLRQLPLCHPIYKLLLPHTRYTLQVNTIARATLLNPEGLVDQVTSIGRQGL  473
            *  * *  * ** ** ***  *** ** **    *   *  *             *

m-8-lox     SDLIKRNMEQLNYSVLCLPEDIRARGVEDIPGYYYRDDGMQIWGAIKSFVSEIVSIYYPS  499
h-15-lox-2  SELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPS  498
bt-15-lox-2 SELIQKNMKQLNYSALCLPDDIRARGVEDIPDYYYRDDGMQVWGAVERFVSEMIGIYYPS  489
m-12r-lox   AQVMVRGLSELTYKSLCIPNDFVERGVQDLPGYYFRDDSLAVWYAMERYVTEIITYYYPN  523
h-12r-lox   AGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPS  523
m-e-lox-3   IYLMSTGLAHFTYTDFCLPDSIRARGVLTIPNYHYRDDGLKIWAAIERFVSEIVSYYYPS  533
h-e-lox-3   IYLMSTGLAHFTYTNFCLPDSLRARGVLAIPNYHYRDDGLKIWAAIESFVSEIVGYYYPS  533
                        *     *     ***   * *  ***    * *    * *    ***

m-8-lox     DTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALVQYITMVIFTCSAKHAAVSS  559
h-15-lox-2  DESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSA  558
bt-15-lox-2 DESVRDDSELQAWVREIFSEGFLGRESSGLPSTLGTREALIQFVTMVIFNCSAKHSAVSA  549
m-12r-lox   DAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNS  583
h-12r-lox   DAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNT  583
m-e-lox-3   DASVQQDCELQAWVGEIFAQAFLGRESSGFPSRLCTPGELVKYLTAIIFNCSAQHAAFNS  593
h-e-lox-3   DASVQQDSELQAWTGEIFAQAFLGRESSGFPSRLCTPGEMVKFLTAIIFNCSAQHAAVNS  593
            *  *  * *** *  ***    *  **** *  * *        *     *** * *

m-8-lox     GQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNSSSYHIIALWLLSAEPGDQR  619
h-15-lox-2  GQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQR  618
bt-15-lox-2 GQFDFAAWMPNLPPSMQLPPPTSKGQARLEGFLATLPPVNATCDVVIALWLLSKEPGDRR  609
m-12r-lox   GQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRR  643
h-12r-lox   GQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRR  643
m-e-lox-3   GQHDFGAWMPNAPSSMRQPPPQTKGDTTMKSYLDTLPEVNTTCRNLLLFWLVSQEPKDQR  653
h-e-lox-3   GQHDFGAWMPNAPSSMRQPPPQTKGTTTLKTYLDTLPEVNISCNNLLLFWLVSQEPKDQR  653
            **     **** *  *  **   **         *** *          *    ** * *

m-8-lox     PLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLALPYTYLDPPLIENSVSI  677
h-15-lox-2  PLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNRGLVLPYTYLDPPLIENSVSI  676
bt-15-lox-2 PLGTYPDEYFTEEAPRRSIAAFQSRLAEISRDIQERNHSLALPYPYLDPPLIENSVSI  667
m-12r-lox   PLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI  701
h-12r-lox   PLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI  701
m-e-lox-3   PLGTYPDEHFTEEAPRQSIAAFQNCLAQISKDIRERNQSLALPYAYLDPPLIENSVSI  711
h-e-lox-3   PLGTYPDEHFTEEAPRRSIAAFQSRLAQISRDIQERNQGLALPYTYLDPPLIENSVSI  711
            ***  **  * *  ** *   *   *  **  *  **  *  ** **** ***** **


Conserved Residues: 232 (min. 32.6%, max. 34.8%)