Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 5-Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


m-5-lox         PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE 60
r-5-lox         PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEE 60
ma-5-lox        PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE 60
h-5-lox         PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEE 60
                *************************:*************.********. **********

m-5-lox         LGEIYLVKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLAR 120
r-5-lox         LGEIYLVKIEKRKYRLHDDWYLKYITLKTPH-DYIEFPCYRWITGEGEIVLRDGCAKLAR 119
ma-5-lox        LGEIQLVRIEKRKYWLHDDWYLKYITLKTPT-DYIEFPCYRWITGEGEIVLRDGRAKLAR 119
h-5-lox         LGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLAR 120
                **** **:****** *:*************  *************: *:***** *****

m-5-lox         DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN 180
r-5-lox         DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN 179
ma-5-lox        DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN 179
h-5-lox         DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN 180
                ****************:*******************************************

m-5-lox         YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC 240
r-5-lox         YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC 239
ma-5-lox        YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC 239
h-5-lox         YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGC 240
                *********************:******************** *****************

m-5-lox         NPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC 300
r-5-lox         NPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC 299
ma-5-lox        NPVLIKRCRELPQKLPVTTEMVECSLERHLSLEQEVQEGNIFIVDYELLDGIDANKTDPC 299
h-5-lox         NPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPC 300
                *****:**  ** ***************:********:*******:**************

m-5-lox         THQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFH 360
r-5-lox         THQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFH 359
ma-5-lox        THQFLAAPICLLYKNLANKIVPIAIQLNQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDFH 359
h-5-lox         TLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFH 360
                * *************************** **:.******:*:*****************

m-5-lox         VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGL 420
r-5-lox         IHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGL 419
ma-5-lox        VHQTITHLLCTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYGL 419
h-5-lox         VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGL 420
                :******** *********************:********************** ** **

m-5-lox         FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEA 480
r-5-lox         FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEA 479
ma-5-lox        FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWEA 479
h-5-lox         FDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEA 480
                *******************::****:*************:..**:*:*************

m-5-lox         IQSFTMEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLT 540
r-5-lox         IQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT 539
ma-5-lox        IQSFTSEVVSIYYEDDQVVMEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT 539
h-5-lox         IRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLT 540
                *::** ***.****.**** ** ******:*********:*:******:****:******

m-5-lox         VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH 600
r-5-lox         VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH 599
ma-5-lox        VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPATAKGVVTIEQIVATLPDRGRSCWH 599
h-5-lox         VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH 600
                ***********************************.************ ***********

m-5-lox         LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYY 660
r-5-lox         LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYY 659
ma-5-lox        LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMTRFRKNLEAIVNVIAERNKNKKLPYY 659
h-5-lox         LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYY 660
                ********************************** *********:.*******:*:****

m-5-lox         YLSPDRIPNSVAI 673
r-5-lox         YLSPDRIPNSVAI 672
ma-5-lox        YLSPDRIPNSVAI 672
h-5-lox         YLSPDRIPNSVAI 673
                *************