Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 5-Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

m5-lox  PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE   60
r5-lox  PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEE   60
hm5-lox PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE   60
h5-lox  PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEE   60
        ************************* ************* ********  **********

m5-lox  LGEIYLVKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLAR  120
r5-lox  LGEIYLVKIEKRKYRLHDDWYLKYITLKTPH-DYIEFPCYRWITGEGEIVLRDGCAKLAR  119
hm5-lox LGEIQLVRIEKRKYWLHDDWYLKYITLKTPT-DYIEFPCYRWITGEGEIVLRDGRAKLAR  119
h5-lox  LGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLAR  120
        **** ** ****** * *************  *************  * ***** *****

m5-lox  DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  180
r5-lox  DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  179
hm5-lox DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  179
h5-lox  DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  180
        **************** *******************************************

m5-lox  YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  240
r5-lox  YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  239
hm5-lox YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  239
h5-lox  YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGC  240
        ********************* ******************** *****************

m5-lox  NPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  300
r5-lox  NPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  299
hm5-lox NPVLIKRCRELPQKLPVTTEMVECSLERHLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  299
h5-lox  NPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPC  300
        ***** **  ** *************** ******** ******* **************

m5-lox  THQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFH  360
r5-lox  THQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFH  359
hm5-lox THQFLAAPICLLYKNLANKIVPIAIQLNQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDFH  359
h5-lox  TLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFH  360
        * *************************** **  ****** * *****************

m5-lox  VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGL  420
r5-lox  IHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGL  419
hm5-lox VHQTITHLLCTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYGL  419
h5-lox  VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGL  420
         ******** ********************* ********************** ** **

m5-lox  FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEA  480
r5-lox  FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEA  479
hm5-lox FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWEA  479
h5-lox  FDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEA  480
        *******************  **** *************   ** * *************

m5-lox  IQSFTMEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLT  540
r5-lox  IQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT  539
hm5-lox IQSFTSEVVSIYYEDDQVVMEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT  539
h5-lox  IRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLT  540
        *  ** *** **** **** ** ****** ********* * ****** **** ******

m5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  600
r5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  599
hm5-lox VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPATAKGVVTIEQIVATLPDRGRSCWH  599
h5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  600
        *********************************** ************ ***********

m5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYY  660
r5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYY  659
hm5-lox LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMTRFRKNLEAIVNVIAERNKNKKLPYY  659
h5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYY  660
        ********************************** *********  ******* * ****

m5-lox  YLSPDRIPNSVAI  673
r5-lox  YLSPDRIPNSVAI  672
hm5-lox YLSPDRIPNSVAI  672
h5-lox  YLSPDRIPNSVAI  673
        ************* 



Conserved Residues: 611 (min. 90.8%, max. 90.9%)


Alignment guide tree:
alignment guide tree