Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 5-Lipoxygenases


Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

m-5-lox  PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE   60
r-5-lox  PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEE   60
ma-5-lox PSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEE   60
h-5-lox  PSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEE   60
         ************************* ************* ********  **********

m-5-lox  LGEIYLVKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLAR  120
r-5-lox  LGEIYLVKIEKRKYRLHDDWYLKYITLKTPH-DYIEFPCYRWITGEGEIVLRDGCAKLAR  119
ma-5-lox LGEIQLVRIEKRKYWLHDDWYLKYITLKTPT-DYIEFPCYRWITGEGEIVLRDGRAKLAR  119
h-5-lox  LGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLAR  120
         **** ** ****** * *************  *************  * ***** *****

m-5-lox  DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  180
r-5-lox  DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  179
ma-5-lox DDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  179
h-5-lox  DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN  180
         **************** *******************************************

m-5-lox  YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  240
r-5-lox  YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  239
ma-5-lox YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC  239
h-5-lox  YSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGC  240
         ********************* ******************** *****************

m-5-lox  NPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  300
r-5-lox  NPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  299
ma-5-lox NPVLIKRCRELPQKLPVTTEMVECSLERHLSLEQEVQEGNIFIVDYELLDGIDANKTDPC  299
h-5-lox  NPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPC  300
         ***** **  ** *************** ******** ******* **************

m-5-lox  THQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFH  360
r-5-lox  THQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFH  359
ma-5-lox THQFLAAPICLLYKNLANKIVPIAIQLNQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDFH  359
h-5-lox  TLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFH  360
         * *************************** **  ****** * *****************

m-5-lox  VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGL  420
r-5-lox  IHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGL  419
ma-5-lox VHQTITHLLCTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYGL  419
h-5-lox  VHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGL  420
          ******** ********************* ********************** ** **

m-5-lox  FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDMPFYFYRDDGLLVWEA  480
r-5-lox  FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEA  479
ma-5-lox FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWEA  479
h-5-lox  FDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEA  480
         *******************  **** *************   ** * *************

m-5-lox  IQSFTMEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLT  540
r-5-lox  IQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT  539
ma-5-lox IQSFTSEVVSIYYEDDQVVMEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT  539
h-5-lox  IRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLT  540
         *  ** *** **** **** ** ****** ********* * ****** **** ******

m-5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  600
r-5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  599
ma-5-lox VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPATAKGVVTIEQIVATLPDRGRSCWH  599
h-5-lox  VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH  600
         *********************************** ************ ***********

m-5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIISVIAERNKNKKLPYY  660
r-5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYY  659
ma-5-lox LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMTRFRKNLEAIVNVIAERNKNKKLPYY  659
h-5-lox  LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYY  660
         ********************************** *********  ******* * ****

m-5-lox  YLSPDRIPNSVAI  673
r-5-lox  YLSPDRIPNSVAI  672
ma-5-lox YLSPDRIPNSVAI  672
h-5-lox  YLSPDRIPNSVAI  673
         *************



Conserved Residues: 611 (min. 90.8%, max. 90.9%)