Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 12S/15S-Lipoxygenases


CLUSTAL W (1.81) multiple sequence alignment


bl-12-lox        GLYRVRVSTGSSFCAGSNNQVHLWLVGEHGEAALGWAVRPARGKEVEFQVDVSEYLGRLL 60
p-12-lox         GLYRVRVSTGSSFYAGSQNQVQLWLVGQHGEAALGWCLRPARGKETEFSVDVSEYLGPLL 60
h-15-lox         GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLL 60
oc-15-lox        GVYRVCVSTGASIYAGSKNKVELWLVGQHGEVELGSCLRPTRNKEEEFKVNVSKYLGSLL 60
oc-12-lox        GVYRVCVSTGASIYAGSKNKVELWLVGQHGEVELGSCLRPSRNKEEEFKVNVSKYLGSLL 60
rn-12-lox        GVYRIRVSTGDSKYAGSNNEVYLWLVGQHGEASLGKLLRPCRDSEAEFKVDVSEYLGPLL 60
ml-12-lox        GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCRNSEAEFKVDVSEYLGPLL 60
                 *:**: **** *  ***:*:* ***:*:***. **  . * *..* *:.*:*.:*** **

bl-12-lox        FVKLRKRHLLSDDAWFCNWISVQGPGASGNEFRFPCYRWVEGDGILSLPEGTGRTVVDDP 120
p-12-lox         FVKLRKRHLLQDDAWFCNWISVQGPGANGDEFRFPCYRWVEGDRILSLPEGTARTVVDDP 120
h-15-lox         FVKLRKRHLLKDDAWFCNWISVQGPGA-GDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP 119
oc-15-lox        FVRLRKKHFLKEDAWFCNWISVQALGAAEDKYWFPCYRWVVGDGVQSLPVGTGCTTVGDP 120
oc-12-lox        FVKLRKKHFLKEDAWFCNWISVQALGAAEDKYWFPCYRWVVGDGVQSLPVGTGCTTVGDP 120
rn-12-lox        FVRVQKWHYLTDDAWFCNWISVKGPGDQGSEYMFPCYRWVQGRSILSLPEGTGCTVVEDS 120
ml-12-lox        FVRVQKWHYLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSILNLPEGTGCTVVEDS 120
                 **:::* * * :**********:. *   .:  ******* *  : .** **. *.  *.

bl-12-lox        QGLFKKHREEELAERRKLYRWGNWKDGLILNIAGATINDLPVDERFLEDKRIDFEASLTK 180
p-12-lox         QGLFKKHREEELAERRKLYRWGNWKDGLILNIASTGIHDLPVDERFLEDKRIDFEASLAK 180
h-15-lox         QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK 179
oc-15-lox        QGLFQKHREQELEERRKLYQWGSWKEGLILNVAGSKLTDLPVDERFLEDKKIDFEASLAW 180
oc-12-lox        QGLFQKHREQELEERRKLYQWGSWKEGLILNVAGSKLTDLPVDERFLEDKKIDFEASLAW 180
rn-12-lox        QGLFRKHREEELEERRSLYRWGNWKDGSILNVAAASISDLPVDQRFREDKRIEFEASQVI 180
ml-12-lox        QGLFRNHREEELEERRSLYRWGNWKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVL 180
                 ****::***:** ***.**:**.**:* ***:*.: : *****:** ***:::**.* .

bl-12-lox        GLADLAIKDSLNILTCWKSLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGTNPML 240
p-12-lox         GLADLAVKDSLNVLMSWNSLDSFNRIFWCGQSKLAEQVRDSWKEDALFGYQFLNGTNPML 240
h-15-lox         GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV 239
oc-15-lox        GLAELALKNSLNILAPWKTLDDFNRIFWCGRSKLARRVRDSWQEDSLFGYQFLNGANPML 240
oc-12-lox        GLAELALKNSLNILAPWKTLDDFNRIFWCGRSKLARRVRDSWQEDSLFGYQFLNGANPML 240
rn-12-lox        GVMDTVVNFPINTVTCWKSLDDFNCVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMV 240
ml-12-lox        GTMDTVINFPKNTVTCWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMV 240
                 *  : .:: . * :  *: **.** :* .*::*:*.:**:**:**::********:**::

bl-12-lox        LRRSVRLPARLEFPPGMGELQAELEKELQQGTLFEADFSLLMGIKANVILCTQQYVAAPL 300
p-12-lox         LRHSVELPARLKFPPGMEELQAQLEKELQGGTLFEADFSLLDGIKANVILCSQQYLAVPL 300
h-15-lox         LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL 299
oc-15-lox        LRRSVQLPARLVFPPGMEELQAQLEKELKAGTLFEADFALLDNIKANVILYCQQYLAAPL 300
oc-12-lox        LRRSVQLPARLVFPPGMEELQAQLEKELKAGTLFEADFALLDNIKANVILYCQQYLAAPL 300
rn-12-lox        LKRSTCLPARLVFPPGMEKLQAQLNKELQKGTLFEADFFLLDGIKANVILCSQQYLAAPL 300
ml-12-lox        LKRSTCLPARLVFPPGMEKLQAQLDEELKKGTLFEADFFLLDGIKANVILCSQQYLAAPL 300
                 *::*. ***** ***** :***:*::**: ******** ** .*******  **::*.**

bl-12-lox        VMLKLQPDGKLLPMAIQLQLPHKGSPPPPLFLPTDPPMTWLLAKCWVRSSDFQLHELHSH 360
p-12-lox         VMLKLQPDGKLLPMVIQLQLPREGSPLPPLFLPTDPPMVWLLAKCWVRSSDFQLHELHSH 360
h-15-lox         VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH 359
oc-15-lox        VMLKLQPDGKLMPMVIQLHLPKIGSSPPPLFLPTDPPMVWLLAKCWVRSSDFQVHELNSH 360
oc-12-lox        VMLKLQPDGKLMPMVIQLHLPKIGSSPPPLFLPTDPPMVWLLAKCWVRSSDLQVHELNSH 360
rn-12-lox        VMLKLMPDGQLLPIAIQLELPKTGSTPPPIFTPSDPPMDWLLAKCWVRSSDLQLHELQAH 360
ml-12-lox        VMLKLQPDGQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAH 360
                 ***** ***:*:*:.***.**: **. **:* * **** ************:*:***::*

bl-12-lox        LLRGHLVAEVIAVATMRCLPSIHPMFKLLIPHLRYTMEINIRARTGLVSDSGVFDQVVST 420
p-12-lox         LLRGHLMAEVIAVATMRCLPSIHPIFKLLIPHFRYTMEINVRARNGLVSDLGIFDQVVST 420
h-15-lox         LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST 419
oc-15-lox        LLRGHLMAEVFTVATMRCLPSIHPVFKLIVPHLRYTLEINVRARNGLVSDFGIFDQIMST 420
oc-12-lox        LLRGHLMAEVFTVATMRCLPSIHPVFKLIVPHLRYTLEINVRARNGLVSDFGIFDQIMST 420
rn-12-lox        LLRGHLMAELFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKAMST 420
ml-12-lox        LLRGHLVAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMST 420
                 ******:**::.*********:**:***::**: **:***:***..*:*: *.**: :**

bl-12-lox        GGGGHVELLQRAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEILSRYVEGIVS 480
p-12-lox         GGGGHVELLRRAAALLTYSSFCPPDDLADRGLLGVESSFYAQDALRLWEVISRYVEGIVS 480
h-15-lox         GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS 479
oc-15-lox        GGGGHVQLLQQAGAFLTYRSFCPPDDLADRGLLGVESSFYAQDALRLWEIISRYVQGIMG 480
oc-12-lox        GGGGHVQLLQQAGAFLTYRSFCPPDDLADRGLLGVESSFYAQDALRLWEIISRYVQGIMG 480
rn-12-lox        GGGGHLDLLKQAGAFLTYCSLCPPDDLAERGLLDIETCFYAKDALRLWQIMNRYVVGMFN 480
ml-12-lox        GGGGHLDLLKQAGAFLTYSSLCPPDDLAERGLLDIDTCFYAKDALQLWQVMNRYVVGMFD 480
                 *****::**::*.*:*** *:*******:****.:.:.***:***:**::: *** *:..

bl-12-lox        LHYKTDESVRDDIELQAWCRDITEIGLLGAQDRGFPVTLQSKDQLCHFVTMCIFTCTGQH 540
p-12-lox         LHYKTDESVKEDFELQAWCREFTEIGLLGAQDRGFPVSLQSKEQLCHFVTMCIFTCTGQH 540
h-15-lox         LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH 539
oc-15-lox        LYYKTDEAVRDDLELQSWCREITEIGLQGAQKQGFPTSLQSVAQACHFVTMCIFTCTGQH 540
oc-12-lox        LYYKTDEAVRDDLELQSWCREITEIGLQGAQKQGFPTSLQSVAQACHFVTMCIFTCTGQH 540
rn-12-lox        LHYKTDKAVQDDYELQSWCREITDIGLQGAQDRGFPTSLQSRAQACYFITMCIFTCTAQH 540
ml-12-lox        LYYKTDQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQH 540
                 *:**** :*::* ***:**:::*:*** ***.:***.:**:  * *:*:********.**

bl-12-lox        SSTHLGQLDWYSWVPNAPCTMRLPPPTTKDVTLEKVMATLPNFHQASLQMSITWQLGRRQ 600
p-12-lox         SSNHLGQLDWYTWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRCQ 600
h-15-lox         ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ 599
oc-15-lox        SSIHLGQLDWFTWVPNAPCTMRLPPPTTKDATLETVMATLPNLHQSSLQMSIVWQLGRDQ 600
oc-12-lox        SSIHLGQLDWFTWVPNAPCTMRLPPPTTKDATLETVMATLPNLHQSSLQMSIVWQLGRDQ 600
rn-12-lox        SSVHLGQLDWFYWVPNAPCTMRLPPPTTKEATMEKLMATLPNPNQSTLQINVVWLLGRRQ 600
ml-12-lox        SSIHLGQLDWFYWVPNAPCTMRLPPPKTKDATMEKLMATLPNPNQSTLQINVVWLLGRRQ 600
                 :* *******: **************.**:.*:*.:****** :*::**:.:.* *** *

bl-12-lox        PIMVALGQHEEEYFSGPEPKAVLKKFREELAALEKDIEIRNAQLDWPYEYLRPSLVENSV 660
p-12-lox         PTMVALGQHEEEYFSGPGPKAVLTKFREELAALDKDIEVRNAKLALPYEYLRPSRVENSV 660
h-15-lox         PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV 659
oc-15-lox        PIMVPLGQHQEEYFSGPEPRAVLEKFREELAIMDKEIEVRNEKLDIPYEYLRPSIVENSV 660
oc-12-lox        PIMVPLGQHQEEYFSGPEPRAVLEKFREELAIMDKEIEVRNEKLDIPYEYLRPSIVENSV 660
rn-12-lox        AVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSMVENSV 660
ml-12-lox        AVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSV 660
                 . **.:***.**:*..* .:*** ******* ::*:**:** .*  ******** *****

bl-12-lox        AI 662
p-12-lox         AI 662
h-15-lox         AI 661
oc-15-lox        AI 662
oc-12-lox        AI 662
rn-12-lox        AI 662
ml-12-lox        AI 662
                 **