Deutsches Krebsforschungszentrum 
German Cancer Resarch CenterLOX-DB - LipOXygenases DataBase
Lipoxygenases...
What are Lipoxygenases?
Lipoxygenases and
cancer research
Database...
Search
Display all entries
Alignments
Sequence Comparison
Blast Search
Search Literature
Search Literature (adv.)
Misc...
Image Gallery
Links
Forum
Contact
Guestbook
Home

 Clustal Alignment of 12S/15S-Lipoxygenases

Legend to the colors:
highly conserved                                     not conserved

CLUSTAL multiple sequence alignment file, generated by Alcon

bl-12-lox GLYRVRVSTGSSFCAGSNNQVHLWLVGEHGEAALGWAVRPARGKEVEFQVDVSEYLGRLL   60
p-12-lox  GLYRVRVSTGSSFYAGSQNQVQLWLVGQHGEAALGWCLRPARGKETEFSVDVSEYLGPLL   60
h-15-lox  GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLL   60
oc-15-lox GVYRVCVSTGASIYAGSKNKVELWLVGQHGEVELGSCLRPTRNKEEEFKVNVSKYLGSLL   60
oc-12-lox GVYRVCVSTGASIYAGSKNKVELWLVGQHGEVELGSCLRPSRNKEEEFKVNVSKYLGSLL   60
rn-12-lox GVYRIRVSTGDSKYAGSNNEVYLWLVGQHGEASLGKLLRPCRDSEAEFKVDVSEYLGPLL   60
ml-12-lox GVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCRNSEAEFKVDVSEYLGPLL   60
          * **  **** *  *** * * *** * ***  **    * *  * *  * *  *** **

bl-12-lox FVKLRKRHLLSDDAWFCNWISVQGPGASGNEFRFPCYRWVEGDGILSLPEGTGRTVVDDP  120
p-12-lox  FVKLRKRHLLQDDAWFCNWISVQGPGANGDEFRFPCYRWVEGDRILSLPEGTARTVVDDP  120
h-15-lox  FVKLRKRHLLKDDAWFCNWISVQGPGA-GDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP  119
oc-15-lox FVRLRKKHFLKEDAWFCNWISVQALGAAEDKYWFPCYRWVVGDGVQSLPVGTGCTTVGDP  120
oc-12-lox FVKLRKKHFLKEDAWFCNWISVQALGAAEDKYWFPCYRWVVGDGVQSLPVGTGCTTVGDP  120
rn-12-lox FVRVQKWHYLTDDAWFCNWISVKGPGDQGSEYMFPCYRWVQGRSILSLPEGTGCTVVEDS  120
ml-12-lox FVRVQKWHYLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSILNLPEGTGCTVVEDS  120
          **   * * *  **********   *       ******* *     ** **  *   *

bl-12-lox QGLFKKHREEELAERRKLYRWGNWKDGLILNIAGATINDLPVDERFLEDKRIDFEASLTK  180
p-12-lox  QGLFKKHREEELAERRKLYRWGNWKDGLILNIASTGIHDLPVDERFLEDKRIDFEASLAK  180
h-15-lox  QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK  179
oc-15-lox QGLFQKHREQELEERRKLYQWGSWKEGLILNVAGSKLTDLPVDERFLEDKKIDFEASLAW  180
oc-12-lox QGLFQKHREQELEERRKLYQWGSWKEGLILNVAGSKLTDLPVDERFLEDKKIDFEASLAW  180
rn-12-lox QGLFRKHREEELEERRSLYRWGNWKDGSILNVAAASISDLPVDQRFREDKRIEFEASQVI  180
ml-12-lox QGLFRNHREEELEERRSLYRWGNWKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVL  180
          ****  *** ** *** ** ** ** * *** *     ***** ** ***   ** *

bl-12-lox GLADLAIKDSLNILTCWKSLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGTNPML  240
p-12-lox  GLADLAVKDSLNVLMSWNSLDSFNRIFWCGQSKLAEQVRDSWKEDALFGYQFLNGTNPML  240
h-15-lox  GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV  239
oc-15-lox GLAELALKNSLNILAPWKTLDDFNRIFWCGRSKLARRVRDSWQEDSLFGYQFLNGANPML  240
oc-12-lox GLAELALKNSLNILAPWKTLDDFNRIFWCGRSKLARRVRDSWQEDSLFGYQFLNGANPML  240
rn-12-lox GVMDTVVNFPINTVTCWKSLDDFNCVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMV  240
ml-12-lox GTMDTVINFPKNTVTCWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMV  240
          *          *    *  ** **  *  *  * *  ** ** **  ******** **

bl-12-lox LRRSVRLPARLEFPPGMGELQAELEKELQQGTLFEADFSLLMGIKANVILCTQQYVAAPL  300
p-12-lox  LRHSVELPARLKFPPGMEELQAQLEKELQGGTLFEADFSLLDGIKANVILCSQQYLAVPL  300
h-15-lox  LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL  299
oc-15-lox LRRSVQLPARLVFPPGMEELQAQLEKELKAGTLFEADFALLDNIKANVILYCQQYLAAPL  300
oc-12-lox LRRSVQLPARLVFPPGMEELQAQLEKELKAGTLFEADFALLDNIKANVILYCQQYLAAPL  300
rn-12-lox LKRSTCLPARLVFPPGMEKLQAQLNKELQKGTLFEADFFLLDGIKANVILCSQQYLAAPL  300
ml-12-lox LKRSTCLPARLVFPPGMEKLQAQLDEELKKGTLFEADFFLLDGIKANVILCSQQYLAAPL  300
          *  *  ***** *****  *** *  **  ******** **  *******  **  * **

bl-12-lox VMLKLQPDGKLLPMAIQLQLPHKGSPPPPLFLPTDPPMTWLLAKCWVRSSDFQLHELHSH  360
p-12-lox  VMLKLQPDGKLLPMVIQLQLPREGSPLPPLFLPTDPPMVWLLAKCWVRSSDFQLHELHSH  360
h-15-lox  VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH  359
oc-15-lox VMLKLQPDGKLMPMVIQLHLPKIGSSPPPLFLPTDPPMVWLLAKCWVRSSDFQVHELNSH  360
oc-12-lox VMLKLQPDGKLMPMVIQLHLPKIGSSPPPLFLPTDPPMVWLLAKCWVRSSDLQVHELNSH  360
rn-12-lox VMLKLMPDGQLLPIAIQLELPKTGSTPPPIFTPSDPPMDWLLAKCWVRSSDLQLHELQAH  360
ml-12-lox VMLKLQPDGQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAH  360
          ***** *** * *  *** **  **  ** * * **** ************ * ***  *

bl-12-lox LLRGHLVAEVIAVATMRCLPSIHPMFKLLIPHLRYTMEINIRARTGLVSDSGVFDQVVST  420
p-12-lox  LLRGHLMAEVIAVATMRCLPSIHPIFKLLIPHFRYTMEINVRARNGLVSDLGIFDQVVST  420
h-15-lox  LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST  419
oc-15-lox LLRGHLMAEVFTVATMRCLPSIHPVFKLIVPHLRYTLEINVRARNGLVSDFGIFDQIMST  420
oc-12-lox LLRGHLMAEVFTVATMRCLPSIHPVFKLIVPHLRYTLEINVRARNGLVSDFGIFDQIMST  420
rn-12-lox LLRGHLMAELFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKAMST  420
ml-12-lox LLRGHLVAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMST  420
          ****** **   ********* ** ***  **  ** *** ***  * *  * **   **

bl-12-lox GGGGHVELLQRAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEILSRYVEGIVS  480
p-12-lox  GGGGHVELLRRAAALLTYSSFCPPDDLADRGLLGVESSFYAQDALRLWEVISRYVEGIVS  480
h-15-lox  GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS  479
oc-15-lox GGGGHVQLLQQAGAFLTYRSFCPPDDLADRGLLGVESSFYAQDALRLWEIISRYVQGIMG  480
oc-12-lox GGGGHVQLLQQAGAFLTYRSFCPPDDLADRGLLGVESSFYAQDALRLWEIISRYVQGIMG  480
rn-12-lox GGGGHLDLLKQAGAFLTYCSLCPPDDLAERGLLDIETCFYAKDALRLWQIMNRYVVGMFN  480
ml-12-lox GGGGHLDLLKQAGAFLTYSSLCPPDDLAERGLLDIDTCFYAKDALQLWQVMNRYVVGMFD  480
          *****  **  * * *** * ******* ****     *** *** **    *** *

bl-12-lox LHYKTDESVRDDIELQAWCRDITEIGLLGAQDRGFPVTLQSKDQLCHFVTMCIFTCTGQH  540
p-12-lox  LHYKTDESVKEDFELQAWCREFTEIGLLGAQDRGFPVSLQSKEQLCHFVTMCIFTCTGQH  540
h-15-lox  LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH  539
oc-15-lox LYYKTDEAVRDDLELQSWCREITEIGLQGAQKQGFPTSLQSVAQACHFVTMCIFTCTGQH  540
oc-12-lox LYYKTDEAVRDDLELQSWCREITEIGLQGAQKQGFPTSLQSVAQACHFVTMCIFTCTGQH  540
rn-12-lox LHYKTDKAVQDDYELQSWCREITDIGLQGAQDRGFPTSLQSRAQACYFITMCIFTCTAQH  540
ml-12-lox LYYKTDQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQH  540
          * ****  *  * *** **   * *** ***  ***  **   * * * ******** **

bl-12-lox SSTHLGQLDWYSWVPNAPCTMRLPPPTTKDVTLEKVMATLPNFHQASLQMSITWQLGRRQ  600
p-12-lox  SSNHLGQLDWYTWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRCQ  600
h-15-lox  ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ  599
oc-15-lox SSIHLGQLDWFTWVPNAPCTMRLPPPTTKDATLETVMATLPNLHQSSLQMSIVWQLGRDQ  600
oc-12-lox SSIHLGQLDWFTWVPNAPCTMRLPPPTTKDATLETVMATLPNLHQSSLQMSIVWQLGRDQ  600
rn-12-lox SSVHLGQLDWFYWVPNAPCTMRLPPPTTKEATMEKLMATLPNPNQSTLQINVVWLLGRRQ  600
ml-12-lox SSIHLGQLDWFYWVPNAPCTMRLPPPKTKDATMEKLMATLPNPNQSTLQINVVWLLGRRQ  600
           * *******  ************** **  * *  ******  *  **    * *** *

bl-12-lox PIMVALGQHEEEYFSGPEPKAVLKKFREELAALEKDIEIRNAQLDWPYEYLRPSLVENSV  660
p-12-lox  PTMVALGQHEEEYFSGPGPKAVLTKFREELAALDKDIEVRNAKLALPYEYLRPSRVENSV  660
h-15-lox  PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV  659
oc-15-lox PIMVPLGQHQEEYFSGPEPRAVLEKFREELAIMDKEIEVRNEKLDIPYEYLRPSIVENSV  660
oc-12-lox PIMVPLGQHQEEYFSGPEPRAVLEKFREELAIMDKEIEVRNEKLDIPYEYLRPSIVENSV  660
rn-12-lox AVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSMVENSV  660
ml-12-lox AVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSV  660
            **  *** ** *  *   *** *******   * ** **  *  ******** *****

bl-12-lox AI  662
p-12-lox  AI  662
h-15-lox  AI  661
oc-15-lox AI  662
oc-12-lox AI  662
rn-12-lox AI  662
ml-12-lox AI  662
          **


Conserved Residues: 400 (min. 60.4%, max. 60.5%)